Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C7N6S2

Protein Details
Accession A0A0C7N6S2   
Localization Confidence Low
Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
18-42KIPATMSRPQKQRQRHRLQNVDDVLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23, nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGPFKPSNTLLGGLLWKIPATMSRPQKQRQRHRLQNVDDVLQKVRLGLHTARSMAKGASFETAVNSSKILKPRIKQLRVLNKNSLFPPEKQMSYRDKYTYFNKQAKQYRKGMHMLPKWTKVSQRRNPRFF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.17
3 0.14
4 0.12
5 0.1
6 0.1
7 0.11
8 0.13
9 0.21
10 0.3
11 0.38
12 0.45
13 0.53
14 0.62
15 0.7
16 0.77
17 0.8
18 0.81
19 0.84
20 0.86
21 0.88
22 0.84
23 0.82
24 0.73
25 0.65
26 0.57
27 0.48
28 0.39
29 0.31
30 0.25
31 0.17
32 0.15
33 0.12
34 0.14
35 0.13
36 0.16
37 0.17
38 0.18
39 0.19
40 0.19
41 0.19
42 0.15
43 0.15
44 0.11
45 0.1
46 0.09
47 0.09
48 0.08
49 0.08
50 0.1
51 0.1
52 0.1
53 0.09
54 0.1
55 0.12
56 0.16
57 0.21
58 0.23
59 0.24
60 0.34
61 0.44
62 0.45
63 0.49
64 0.54
65 0.6
66 0.64
67 0.68
68 0.66
69 0.58
70 0.58
71 0.52
72 0.5
73 0.41
74 0.34
75 0.36
76 0.32
77 0.32
78 0.3
79 0.35
80 0.36
81 0.38
82 0.42
83 0.38
84 0.37
85 0.39
86 0.44
87 0.5
88 0.51
89 0.54
90 0.54
91 0.6
92 0.68
93 0.72
94 0.73
95 0.71
96 0.68
97 0.67
98 0.66
99 0.64
100 0.64
101 0.62
102 0.64
103 0.63
104 0.63
105 0.62
106 0.61
107 0.63
108 0.63
109 0.68
110 0.68
111 0.73