Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C7MUL6

Protein Details
Accession A0A0C7MUL6    Localization Confidence Low Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
129-148ANEKRGQGFRKIRNRQFLLAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, cyto_nucl 11.5, cyto 8, mito 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR011012  Longin-like_dom_sf  
IPR007233  TRAPPC  
Gene Ontology GO:0005783  C:endoplasmic reticulum  
GO:0005794  C:Golgi apparatus  
GO:0030008  C:TRAPP complex  
GO:0006888  P:endoplasmic reticulum to Golgi vesicle-mediated transport  
Pfam View protein in Pfam  
PF04099  Sybindin  
CDD cd14855  TRAPPC1_MUM2  
Amino Acid Sequences MAIYSFWIFDRHCNCIFDREWTLKTNPSSGTTNSKLNEDTAKLLYGMIFSLRSISQKLGSLDSFNEIRTIATAKYRAHILCTASGLWFVLLSDLKQEDLSQVLRYLYSEIYVKTVVYNWLSPVDFAETANEKRGQGFRKIRNRQFLLAVEQFLGPMVN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.37
3 0.37
4 0.36
5 0.38
6 0.37
7 0.37
8 0.39
9 0.4
10 0.4
11 0.4
12 0.38
13 0.33
14 0.32
15 0.33
16 0.32
17 0.37
18 0.34
19 0.38
20 0.34
21 0.35
22 0.31
23 0.3
24 0.3
25 0.24
26 0.23
27 0.19
28 0.19
29 0.17
30 0.16
31 0.14
32 0.11
33 0.09
34 0.07
35 0.06
36 0.05
37 0.07
38 0.07
39 0.09
40 0.1
41 0.11
42 0.11
43 0.15
44 0.16
45 0.16
46 0.16
47 0.16
48 0.15
49 0.17
50 0.16
51 0.12
52 0.12
53 0.09
54 0.09
55 0.09
56 0.1
57 0.07
58 0.09
59 0.13
60 0.12
61 0.13
62 0.16
63 0.15
64 0.16
65 0.18
66 0.16
67 0.14
68 0.15
69 0.14
70 0.11
71 0.11
72 0.09
73 0.07
74 0.05
75 0.04
76 0.05
77 0.04
78 0.04
79 0.06
80 0.06
81 0.07
82 0.07
83 0.07
84 0.06
85 0.08
86 0.09
87 0.08
88 0.09
89 0.09
90 0.09
91 0.09
92 0.1
93 0.09
94 0.09
95 0.09
96 0.09
97 0.1
98 0.11
99 0.1
100 0.09
101 0.11
102 0.12
103 0.13
104 0.13
105 0.12
106 0.15
107 0.15
108 0.15
109 0.15
110 0.16
111 0.14
112 0.14
113 0.17
114 0.18
115 0.19
116 0.24
117 0.25
118 0.21
119 0.25
120 0.31
121 0.31
122 0.37
123 0.45
124 0.51
125 0.6
126 0.7
127 0.75
128 0.79
129 0.8
130 0.74
131 0.69
132 0.63
133 0.6
134 0.52
135 0.45
136 0.36
137 0.31
138 0.27