Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C7N596

Protein Details
Accession A0A0C7N596    Localization Confidence High Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MSKSKNHTNHNQTRKAHRNGIKKPKTYHydrophilic
NLS Segment(s)
PositionSequence
14-58RKAHRNGIKKPKTYKYPSLKGVDAKFRRNHKHALHGTQKALAAKR
Subcellular Location(s) nucl 20, mito 4, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MSKSKNHTNHNQTRKAHRNGIKKPKTYKYPSLKGVDAKFRRNHKHALHGTQKALAAKRAEEAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.79
3 0.77
4 0.75
5 0.75
6 0.77
7 0.82
8 0.8
9 0.77
10 0.78
11 0.77
12 0.78
13 0.74
14 0.74
15 0.72
16 0.7
17 0.69
18 0.64
19 0.59
20 0.54
21 0.5
22 0.51
23 0.45
24 0.45
25 0.46
26 0.51
27 0.56
28 0.55
29 0.61
30 0.55
31 0.62
32 0.62
33 0.64
34 0.65
35 0.62
36 0.6
37 0.54
38 0.53
39 0.47
40 0.43
41 0.39
42 0.32
43 0.28