Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q4WX71

Protein Details
Accession Q4WX71   
Localization Confidence Low
Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
102-126LDGETRKGKEEKKRQQHQQHPEGLABasic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 11, mito 5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR022024  DUF3602  
KEGG afm:AFUA_3G08440  -  
Pfam View protein in Pfam  
PF12223  DUF3602  
Amino Acid Sequences MPVHSNPHKPSLNTHRKPGQGNIGADPTQYVDAGIVREGPYGDQGDGAYSAGRGGAGNIGSPNVRPTSRVPHDAEIIPELAIRKSTDENYHVGRGGQGNVHLDGETRKGKEEKKRQQHQQHPEGLADKLKHKLLGRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.64
3 0.65
4 0.68
5 0.64
6 0.63
7 0.58
8 0.56
9 0.5
10 0.47
11 0.41
12 0.37
13 0.32
14 0.23
15 0.16
16 0.14
17 0.11
18 0.07
19 0.08
20 0.08
21 0.08
22 0.08
23 0.08
24 0.08
25 0.08
26 0.08
27 0.09
28 0.1
29 0.1
30 0.09
31 0.08
32 0.08
33 0.09
34 0.09
35 0.06
36 0.05
37 0.05
38 0.04
39 0.04
40 0.04
41 0.04
42 0.05
43 0.05
44 0.05
45 0.05
46 0.06
47 0.06
48 0.06
49 0.08
50 0.08
51 0.08
52 0.1
53 0.12
54 0.21
55 0.24
56 0.29
57 0.29
58 0.29
59 0.32
60 0.3
61 0.29
62 0.21
63 0.18
64 0.13
65 0.11
66 0.1
67 0.08
68 0.08
69 0.08
70 0.09
71 0.1
72 0.13
73 0.15
74 0.17
75 0.2
76 0.22
77 0.23
78 0.21
79 0.2
80 0.19
81 0.17
82 0.16
83 0.14
84 0.13
85 0.13
86 0.14
87 0.14
88 0.12
89 0.12
90 0.12
91 0.16
92 0.18
93 0.17
94 0.21
95 0.25
96 0.32
97 0.42
98 0.53
99 0.59
100 0.65
101 0.75
102 0.82
103 0.88
104 0.91
105 0.91
106 0.89
107 0.86
108 0.77
109 0.71
110 0.62
111 0.54
112 0.49
113 0.42
114 0.36
115 0.33
116 0.33
117 0.35