Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C7MY19

Protein Details
Accession A0A0C7MY19   
Localization Confidence Low
Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
62-97FTDSVMRKRRLKMKKHKLRKRRKRQKAEKRKKSQGKBasic
NLS Segment(s)
PositionSequence
68-97RKRRLKMKKHKLRKRRKRQKAEKRKKSQGK
Subcellular Location(s) mito 19.5, mito_nucl 14, nucl 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013177  COX24_C  
Pfam View protein in Pfam  
PF08213  COX24_C  
Amino Acid Sequences MLSAFRQLAARALLKPRVSSAIGRSGMHTFQSHTILTQSAMPVSLLKPIVPMEPNTTPEELFTDSVMRKRRLKMKKHKLRKRRKRQKAEKRKKSQGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.32
3 0.3
4 0.31
5 0.3
6 0.29
7 0.27
8 0.3
9 0.31
10 0.3
11 0.3
12 0.28
13 0.27
14 0.26
15 0.23
16 0.16
17 0.16
18 0.18
19 0.16
20 0.14
21 0.15
22 0.13
23 0.13
24 0.12
25 0.1
26 0.07
27 0.08
28 0.07
29 0.07
30 0.07
31 0.09
32 0.08
33 0.08
34 0.08
35 0.09
36 0.1
37 0.1
38 0.11
39 0.13
40 0.15
41 0.17
42 0.19
43 0.19
44 0.17
45 0.17
46 0.18
47 0.15
48 0.14
49 0.11
50 0.13
51 0.13
52 0.18
53 0.25
54 0.28
55 0.31
56 0.37
57 0.47
58 0.53
59 0.63
60 0.69
61 0.74
62 0.81
63 0.87
64 0.91
65 0.93
66 0.95
67 0.95
68 0.95
69 0.95
70 0.96
71 0.96
72 0.97
73 0.97
74 0.97
75 0.98
76 0.97
77 0.97