Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C7N4R9

Protein Details
Accession A0A0C7N4R9    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-34MDAFALKKDNRKKFQDKEKLKRKHATPSDRKYRABasic
NLS Segment(s)
PositionSequence
8-28KDNRKKFQDKEKLKRKHATPS
Subcellular Location(s) nucl 25, cyto_nucl 15.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR035303  DUF5364  
Pfam View protein in Pfam  
PF17322  DUF5364  
Amino Acid Sequences MDAFALKKDNRKKFQDKEKLKRKHATPSDRKYRALNKTTEPEPEVPELQANHYRYHEDLSMTYQTQNDDDSNVGTTNKKLKEILLARQNNTDHDSQYQTKSPSHLTRKELDSMSVAELNRLLGNKQNDSISIKPDAGGSKNDNTRFSNHVRGTPAALKSEIPTKTSKSKVPVDLESEQDQLDELI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.87
3 0.88
4 0.88
5 0.91
6 0.91
7 0.9
8 0.89
9 0.82
10 0.82
11 0.81
12 0.81
13 0.81
14 0.82
15 0.84
16 0.79
17 0.77
18 0.74
19 0.73
20 0.71
21 0.68
22 0.62
23 0.58
24 0.59
25 0.59
26 0.55
27 0.5
28 0.42
29 0.38
30 0.36
31 0.31
32 0.25
33 0.26
34 0.22
35 0.23
36 0.27
37 0.25
38 0.24
39 0.24
40 0.25
41 0.23
42 0.26
43 0.23
44 0.17
45 0.16
46 0.18
47 0.19
48 0.19
49 0.19
50 0.17
51 0.16
52 0.15
53 0.16
54 0.12
55 0.1
56 0.1
57 0.09
58 0.1
59 0.1
60 0.1
61 0.09
62 0.11
63 0.17
64 0.18
65 0.18
66 0.18
67 0.18
68 0.25
69 0.28
70 0.32
71 0.35
72 0.37
73 0.37
74 0.4
75 0.4
76 0.34
77 0.33
78 0.28
79 0.19
80 0.17
81 0.2
82 0.18
83 0.2
84 0.22
85 0.21
86 0.21
87 0.22
88 0.25
89 0.29
90 0.34
91 0.38
92 0.38
93 0.41
94 0.42
95 0.45
96 0.4
97 0.33
98 0.27
99 0.22
100 0.2
101 0.19
102 0.16
103 0.12
104 0.12
105 0.12
106 0.11
107 0.1
108 0.09
109 0.12
110 0.15
111 0.17
112 0.18
113 0.18
114 0.19
115 0.23
116 0.24
117 0.22
118 0.21
119 0.19
120 0.18
121 0.2
122 0.2
123 0.17
124 0.2
125 0.21
126 0.25
127 0.32
128 0.34
129 0.36
130 0.35
131 0.37
132 0.38
133 0.39
134 0.42
135 0.38
136 0.4
137 0.4
138 0.39
139 0.41
140 0.41
141 0.38
142 0.31
143 0.3
144 0.27
145 0.25
146 0.31
147 0.27
148 0.24
149 0.25
150 0.28
151 0.36
152 0.4
153 0.43
154 0.43
155 0.5
156 0.55
157 0.57
158 0.57
159 0.55
160 0.53
161 0.53
162 0.49
163 0.42
164 0.34
165 0.28