Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C7N1T1

Protein Details
Accession A0A0C7N1T1    Localization Confidence Low Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
3-29VQTPKQRIANQKFAKRNEKKLGKAKKTHydrophilic
NLS Segment(s)
PositionSequence
14-28KFAKRNEKKLGKAKK
Subcellular Location(s) mito 7, plas 5, golg 5, E.R. 4, cyto 2.5, cyto_nucl 2.5, nucl 1.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR010580  ER_stress-assoc  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0015031  P:protein transport  
Pfam View protein in Pfam  
PF06624  RAMP4  
Amino Acid Sequences MAVQTPKQRIANQKFAKRNEKKLGKAKKTESKSSLALPNYWVFGLLFLLIGGGVLELISLFL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.75
3 0.8
4 0.77
5 0.78
6 0.78
7 0.77
8 0.76
9 0.78
10 0.81
11 0.77
12 0.78
13 0.76
14 0.75
15 0.72
16 0.7
17 0.63
18 0.56
19 0.5
20 0.46
21 0.43
22 0.35
23 0.3
24 0.26
25 0.23
26 0.2
27 0.19
28 0.16
29 0.1
30 0.09
31 0.09
32 0.07
33 0.06
34 0.04
35 0.05
36 0.04
37 0.04
38 0.03
39 0.03
40 0.02
41 0.02
42 0.02