Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C7MXZ9

Protein Details
Accession A0A0C7MXZ9   
Localization Confidence Medium
Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
92-118LTKFEATRITPKQRKRQIAFPQRKFAIHydrophilic
NLS Segment(s)
PositionSequence
77-115PKDQRAKKTRALRRALTKFEATRITPKQRKRQIAFPQRK
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MAGIKAYELRTKSKEQLESQLVDLKKELATLKVQKLSRPSLPKIHTVRKDIARVLTIINENQRQAVRELYKGSKFQPKDQRAKKTRALRRALTKFEATRITPKQRKRQIAFPQRKFAIKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.49
3 0.55
4 0.54
5 0.51
6 0.48
7 0.47
8 0.4
9 0.34
10 0.31
11 0.23
12 0.18
13 0.19
14 0.17
15 0.13
16 0.19
17 0.25
18 0.29
19 0.34
20 0.35
21 0.36
22 0.4
23 0.43
24 0.43
25 0.44
26 0.43
27 0.44
28 0.46
29 0.52
30 0.53
31 0.58
32 0.56
33 0.53
34 0.56
35 0.52
36 0.52
37 0.45
38 0.4
39 0.32
40 0.27
41 0.23
42 0.19
43 0.15
44 0.14
45 0.15
46 0.15
47 0.14
48 0.15
49 0.15
50 0.14
51 0.14
52 0.18
53 0.16
54 0.17
55 0.2
56 0.22
57 0.25
58 0.26
59 0.28
60 0.31
61 0.32
62 0.39
63 0.46
64 0.51
65 0.58
66 0.65
67 0.73
68 0.71
69 0.76
70 0.76
71 0.76
72 0.76
73 0.75
74 0.74
75 0.7
76 0.74
77 0.74
78 0.71
79 0.65
80 0.62
81 0.54
82 0.51
83 0.49
84 0.41
85 0.42
86 0.44
87 0.51
88 0.53
89 0.61
90 0.67
91 0.73
92 0.81
93 0.77
94 0.8
95 0.8
96 0.84
97 0.86
98 0.83
99 0.83
100 0.77