Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C7N4X0

Protein Details
Accession A0A0C7N4X0    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
177-197VDNAPAKKPRKPRAKKTAGPSHydrophilic
NLS Segment(s)
PositionSequence
182-193AKKPRKPRAKKT
Subcellular Location(s) nucl 23.5, cyto_nucl 15
Family & Domain DBs
InterPro View protein in InterPro  
IPR020998  Med3  
Gene Ontology GO:0016592  C:mediator complex  
GO:0003712  F:transcription coregulator activity  
GO:0006357  P:regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF11593  Med3  
Amino Acid Sequences MEAMADGVTNTQTPDSKSHSVDKVFERLGSDDSYKDSVKQELQHVQDSILPMRLKFNELLSTLAAIDRKGESSSAETFNQIRTKLLEFISGVQQFSSDYGKLQPLFERLQEVSKSEDTIVNFVPLERLSRLNDASTTASGGKISNGNSPSANFVSTGKQAPSNAQTPLSNVPTPSSVDNAPAKKPRKPRAKKTAGPSPSSIAPQQQQQQKQQPQQHQQPQPPQQHFTPATNPSQILQSMSPMNMMSSPMNTISPMNNAAPISQIPFSAPSKPPMQQQQRHVQQTPQQQFNLDSITPANILHMSMSDHGNTPHAQQTNSQQQQQQQQPQPQQQQQHLQSSNQDFSALDINNIDLSSLNMDFLQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.27
3 0.31
4 0.35
5 0.41
6 0.45
7 0.46
8 0.5
9 0.5
10 0.49
11 0.45
12 0.43
13 0.38
14 0.33
15 0.32
16 0.3
17 0.27
18 0.21
19 0.23
20 0.26
21 0.24
22 0.25
23 0.25
24 0.26
25 0.29
26 0.32
27 0.36
28 0.39
29 0.43
30 0.44
31 0.42
32 0.38
33 0.36
34 0.34
35 0.29
36 0.27
37 0.24
38 0.2
39 0.25
40 0.26
41 0.26
42 0.25
43 0.26
44 0.24
45 0.24
46 0.26
47 0.21
48 0.2
49 0.17
50 0.18
51 0.16
52 0.11
53 0.12
54 0.11
55 0.12
56 0.12
57 0.12
58 0.12
59 0.15
60 0.19
61 0.21
62 0.2
63 0.22
64 0.22
65 0.27
66 0.29
67 0.25
68 0.22
69 0.22
70 0.23
71 0.25
72 0.24
73 0.22
74 0.19
75 0.21
76 0.27
77 0.25
78 0.23
79 0.19
80 0.19
81 0.16
82 0.17
83 0.17
84 0.1
85 0.1
86 0.12
87 0.16
88 0.17
89 0.18
90 0.19
91 0.2
92 0.22
93 0.21
94 0.23
95 0.2
96 0.24
97 0.23
98 0.22
99 0.22
100 0.21
101 0.22
102 0.19
103 0.21
104 0.17
105 0.18
106 0.18
107 0.14
108 0.14
109 0.12
110 0.13
111 0.1
112 0.12
113 0.11
114 0.13
115 0.14
116 0.17
117 0.18
118 0.17
119 0.17
120 0.17
121 0.17
122 0.15
123 0.14
124 0.11
125 0.11
126 0.11
127 0.1
128 0.09
129 0.1
130 0.11
131 0.15
132 0.15
133 0.16
134 0.16
135 0.16
136 0.18
137 0.17
138 0.16
139 0.11
140 0.12
141 0.13
142 0.15
143 0.16
144 0.14
145 0.15
146 0.15
147 0.16
148 0.19
149 0.18
150 0.17
151 0.17
152 0.16
153 0.17
154 0.2
155 0.21
156 0.18
157 0.16
158 0.16
159 0.15
160 0.16
161 0.15
162 0.13
163 0.1
164 0.13
165 0.17
166 0.18
167 0.21
168 0.28
169 0.3
170 0.34
171 0.44
172 0.5
173 0.57
174 0.64
175 0.71
176 0.75
177 0.82
178 0.82
179 0.79
180 0.8
181 0.73
182 0.66
183 0.57
184 0.48
185 0.4
186 0.36
187 0.29
188 0.22
189 0.19
190 0.21
191 0.26
192 0.3
193 0.33
194 0.39
195 0.48
196 0.53
197 0.59
198 0.63
199 0.65
200 0.67
201 0.72
202 0.74
203 0.72
204 0.71
205 0.72
206 0.74
207 0.74
208 0.68
209 0.62
210 0.53
211 0.54
212 0.49
213 0.43
214 0.4
215 0.34
216 0.34
217 0.32
218 0.32
219 0.24
220 0.24
221 0.21
222 0.17
223 0.14
224 0.13
225 0.13
226 0.13
227 0.13
228 0.11
229 0.11
230 0.09
231 0.11
232 0.09
233 0.08
234 0.09
235 0.09
236 0.1
237 0.1
238 0.11
239 0.1
240 0.12
241 0.14
242 0.13
243 0.14
244 0.14
245 0.14
246 0.14
247 0.13
248 0.14
249 0.12
250 0.11
251 0.1
252 0.14
253 0.15
254 0.2
255 0.21
256 0.22
257 0.26
258 0.28
259 0.33
260 0.4
261 0.49
262 0.5
263 0.56
264 0.63
265 0.68
266 0.73
267 0.69
268 0.64
269 0.61
270 0.64
271 0.64
272 0.59
273 0.5
274 0.45
275 0.44
276 0.41
277 0.38
278 0.27
279 0.21
280 0.16
281 0.17
282 0.15
283 0.14
284 0.13
285 0.09
286 0.09
287 0.09
288 0.09
289 0.09
290 0.11
291 0.12
292 0.12
293 0.13
294 0.14
295 0.16
296 0.16
297 0.17
298 0.22
299 0.23
300 0.23
301 0.25
302 0.33
303 0.42
304 0.46
305 0.48
306 0.45
307 0.49
308 0.58
309 0.64
310 0.65
311 0.62
312 0.66
313 0.7
314 0.76
315 0.79
316 0.76
317 0.75
318 0.72
319 0.74
320 0.71
321 0.72
322 0.65
323 0.58
324 0.6
325 0.59
326 0.54
327 0.44
328 0.38
329 0.28
330 0.27
331 0.32
332 0.24
333 0.18
334 0.16
335 0.17
336 0.17
337 0.17
338 0.15
339 0.08
340 0.09
341 0.12
342 0.11