Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C7MMD6

Protein Details
Accession A0A0C7MMD6   
Localization Confidence Low
Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
2-32VNVPKTRRTYCKGKQCRKHTQHKVTQYKAGKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, nucl 8.5, cyto_nucl 8.5, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVNVPKTRRTYCKGKQCRKHTQHKVTQYKAGKASLFAQGKRRYDRKQSGFGGQTKPVFHKKAKVTKKVVLRLECVACKTRAQLCLKRCKHFELGGEKKQKGQALQF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.84
3 0.86
4 0.9
5 0.89
6 0.91
7 0.91
8 0.9
9 0.89
10 0.89
11 0.89
12 0.82
13 0.82
14 0.75
15 0.7
16 0.62
17 0.56
18 0.45
19 0.37
20 0.35
21 0.34
22 0.33
23 0.29
24 0.34
25 0.38
26 0.42
27 0.47
28 0.52
29 0.49
30 0.55
31 0.63
32 0.6
33 0.61
34 0.59
35 0.58
36 0.56
37 0.55
38 0.48
39 0.41
40 0.37
41 0.3
42 0.31
43 0.31
44 0.3
45 0.27
46 0.32
47 0.37
48 0.45
49 0.53
50 0.59
51 0.59
52 0.61
53 0.68
54 0.69
55 0.67
56 0.6
57 0.54
58 0.5
59 0.47
60 0.43
61 0.37
62 0.33
63 0.27
64 0.25
65 0.27
66 0.27
67 0.31
68 0.37
69 0.42
70 0.47
71 0.56
72 0.62
73 0.66
74 0.64
75 0.62
76 0.61
77 0.58
78 0.57
79 0.57
80 0.6
81 0.62
82 0.67
83 0.62
84 0.61
85 0.61
86 0.57