Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C7NED0

Protein Details
Accession A0A0C7NED0    Localization Confidence Low Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
77-105LQKDPLKLRRKQLRTSNRQKIKQNNFLSEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MLRRFPISQSVRLLSSSRIAFQQAKTGSEKVISSCPAGTVLNLQIKKSGKEPVALEDHEYPEWLWSVLDEDAQLKMLQKDPLKLRRKQLRTSNRQKIKQNNFLSEI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.31
3 0.26
4 0.22
5 0.21
6 0.23
7 0.25
8 0.24
9 0.3
10 0.26
11 0.28
12 0.3
13 0.29
14 0.26
15 0.24
16 0.24
17 0.18
18 0.2
19 0.18
20 0.16
21 0.15
22 0.15
23 0.14
24 0.14
25 0.12
26 0.1
27 0.13
28 0.18
29 0.18
30 0.18
31 0.21
32 0.22
33 0.23
34 0.23
35 0.24
36 0.19
37 0.22
38 0.23
39 0.22
40 0.24
41 0.23
42 0.23
43 0.2
44 0.21
45 0.17
46 0.17
47 0.13
48 0.1
49 0.1
50 0.08
51 0.06
52 0.05
53 0.07
54 0.07
55 0.07
56 0.07
57 0.07
58 0.07
59 0.08
60 0.08
61 0.08
62 0.09
63 0.13
64 0.18
65 0.19
66 0.25
67 0.33
68 0.43
69 0.49
70 0.54
71 0.61
72 0.66
73 0.71
74 0.74
75 0.77
76 0.78
77 0.81
78 0.86
79 0.87
80 0.87
81 0.88
82 0.88
83 0.88
84 0.87
85 0.86
86 0.83