Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C7N428

Protein Details
Accession A0A0C7N428   
Localization Confidence Medium
Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
287-311LAIKRGPKSQLGRRRWPRIYPIQTTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011010  DNA_brk_join_enz  
IPR013762  Integrase-like_cat_sf  
IPR005626  Recombinase_Flp_C  
IPR022647  Recombinase_Flp_N  
Gene Ontology GO:0003677  F:DNA binding  
GO:0015074  P:DNA integration  
GO:0006310  P:DNA recombination  
Pfam View protein in Pfam  
PF05202  Flp_C  
PF03930  Flp_N  
PROSITE View protein in PROSITE  
PS51899  TYR_RECOMBINASE_FLP  
Amino Acid Sequences MTPQTLLFEELASRTLTSVLEELQDVFAGDRAYLRDRVAALLTYTIMGTFGKLRELRRSTFISYERLIRRSLKHNKETNVVSFSYHLKDPKQLTDALNEAFAPVVFEVASNKPPSVEAVSQQRDQEDDFSLNRTADGEIIKVVRADDIWDLLSDIKRTIEKKVMKRRLSAEMKYVLTVSFFNCALFNDLKNADPTKFELVENEYLGHILRVLVSETMTRIPRYLYFFPVNSPSDPLLALHGLFSQVKPTPKTRSSQQETEQRWQMLRESLLNAYDRFLRRHTQHAILAIKRGPKSQLGRRRWPRIYPIQTTANGLRVSAIGMIG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.11
4 0.11
5 0.12
6 0.11
7 0.11
8 0.12
9 0.12
10 0.12
11 0.12
12 0.1
13 0.09
14 0.1
15 0.09
16 0.09
17 0.1
18 0.12
19 0.16
20 0.18
21 0.18
22 0.19
23 0.19
24 0.21
25 0.21
26 0.19
27 0.16
28 0.15
29 0.14
30 0.12
31 0.11
32 0.09
33 0.08
34 0.07
35 0.07
36 0.09
37 0.09
38 0.16
39 0.19
40 0.22
41 0.31
42 0.36
43 0.38
44 0.4
45 0.44
46 0.41
47 0.45
48 0.45
49 0.4
50 0.37
51 0.43
52 0.42
53 0.4
54 0.4
55 0.38
56 0.4
57 0.46
58 0.55
59 0.56
60 0.6
61 0.66
62 0.66
63 0.68
64 0.66
65 0.6
66 0.53
67 0.43
68 0.35
69 0.29
70 0.28
71 0.25
72 0.24
73 0.22
74 0.2
75 0.26
76 0.28
77 0.31
78 0.3
79 0.31
80 0.3
81 0.3
82 0.31
83 0.25
84 0.23
85 0.18
86 0.15
87 0.12
88 0.1
89 0.08
90 0.05
91 0.05
92 0.04
93 0.05
94 0.07
95 0.09
96 0.12
97 0.12
98 0.12
99 0.12
100 0.13
101 0.14
102 0.16
103 0.15
104 0.16
105 0.24
106 0.28
107 0.3
108 0.3
109 0.29
110 0.25
111 0.25
112 0.23
113 0.16
114 0.14
115 0.13
116 0.15
117 0.15
118 0.15
119 0.14
120 0.13
121 0.11
122 0.1
123 0.1
124 0.08
125 0.08
126 0.08
127 0.08
128 0.08
129 0.07
130 0.06
131 0.06
132 0.07
133 0.06
134 0.06
135 0.06
136 0.06
137 0.07
138 0.08
139 0.08
140 0.08
141 0.08
142 0.08
143 0.1
144 0.11
145 0.14
146 0.21
147 0.27
148 0.36
149 0.46
150 0.55
151 0.55
152 0.58
153 0.59
154 0.61
155 0.6
156 0.52
157 0.46
158 0.41
159 0.38
160 0.35
161 0.31
162 0.21
163 0.16
164 0.15
165 0.11
166 0.08
167 0.08
168 0.08
169 0.08
170 0.08
171 0.11
172 0.11
173 0.11
174 0.12
175 0.13
176 0.13
177 0.15
178 0.17
179 0.14
180 0.14
181 0.16
182 0.17
183 0.17
184 0.17
185 0.16
186 0.18
187 0.2
188 0.19
189 0.17
190 0.13
191 0.12
192 0.12
193 0.1
194 0.07
195 0.05
196 0.05
197 0.05
198 0.05
199 0.05
200 0.06
201 0.07
202 0.07
203 0.11
204 0.12
205 0.12
206 0.12
207 0.13
208 0.16
209 0.22
210 0.23
211 0.26
212 0.27
213 0.27
214 0.29
215 0.33
216 0.32
217 0.26
218 0.27
219 0.22
220 0.2
221 0.19
222 0.17
223 0.14
224 0.12
225 0.11
226 0.09
227 0.08
228 0.1
229 0.1
230 0.1
231 0.12
232 0.15
233 0.19
234 0.22
235 0.27
236 0.34
237 0.37
238 0.42
239 0.46
240 0.53
241 0.56
242 0.6
243 0.63
244 0.65
245 0.67
246 0.7
247 0.68
248 0.6
249 0.53
250 0.47
251 0.42
252 0.37
253 0.33
254 0.28
255 0.25
256 0.24
257 0.26
258 0.26
259 0.24
260 0.21
261 0.25
262 0.25
263 0.25
264 0.27
265 0.32
266 0.33
267 0.41
268 0.45
269 0.44
270 0.44
271 0.49
272 0.53
273 0.47
274 0.49
275 0.44
276 0.45
277 0.41
278 0.41
279 0.36
280 0.38
281 0.44
282 0.5
283 0.57
284 0.59
285 0.69
286 0.76
287 0.84
288 0.82
289 0.81
290 0.8
291 0.81
292 0.8
293 0.76
294 0.72
295 0.69
296 0.64
297 0.62
298 0.55
299 0.5
300 0.42
301 0.34
302 0.29
303 0.22
304 0.22