Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C7MPN1

Protein Details
Accession A0A0C7MPN1   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
83-104FGWGNKTRQRVKRQEKLLEERIHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 13cyto_nucl 13, nucl 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR011431  Trafficking_Pga2  
Pfam View protein in Pfam  
PF07543  PGA2  
Amino Acid Sequences MELLDNAYQTLYASVASLDAQRIIRLVIIVGGYALLRNLAQRHLAKRQLDRKVREGQLAKDEKRVEELVDDPNSAQSAESNAFGWGNKTRQRVKRQEKLLEERIEELQKYQGNLDDDQDIADLLED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.07
4 0.08
5 0.08
6 0.1
7 0.11
8 0.11
9 0.11
10 0.11
11 0.1
12 0.09
13 0.09
14 0.07
15 0.06
16 0.06
17 0.05
18 0.05
19 0.05
20 0.05
21 0.05
22 0.04
23 0.04
24 0.06
25 0.07
26 0.08
27 0.14
28 0.17
29 0.22
30 0.28
31 0.35
32 0.37
33 0.45
34 0.52
35 0.56
36 0.61
37 0.6
38 0.59
39 0.61
40 0.59
41 0.57
42 0.51
43 0.44
44 0.45
45 0.47
46 0.42
47 0.39
48 0.38
49 0.31
50 0.32
51 0.3
52 0.21
53 0.15
54 0.16
55 0.15
56 0.15
57 0.15
58 0.12
59 0.13
60 0.13
61 0.11
62 0.09
63 0.05
64 0.07
65 0.08
66 0.08
67 0.08
68 0.09
69 0.09
70 0.09
71 0.11
72 0.13
73 0.17
74 0.22
75 0.28
76 0.37
77 0.45
78 0.56
79 0.64
80 0.71
81 0.74
82 0.78
83 0.8
84 0.8
85 0.8
86 0.79
87 0.72
88 0.63
89 0.57
90 0.52
91 0.46
92 0.38
93 0.3
94 0.28
95 0.26
96 0.25
97 0.24
98 0.25
99 0.25
100 0.26
101 0.26
102 0.22
103 0.19
104 0.19
105 0.18
106 0.13