Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C7N0W3

Protein Details
Accession A0A0C7N0W3   
Localization Confidence Low
Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
74-98MLKTAYLKRKTNKYRHKLEQVRDSVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, cyto_nucl 12.5, cyto 8, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR023261  Autophagy-related_protein_14  
IPR018791  UV_resistance/autophagy_Atg14  
Gene Ontology GO:0032991  C:protein-containing complex  
GO:0005774  C:vacuolar membrane  
GO:0016236  P:macroautophagy  
Pfam View protein in Pfam  
PF10186  ATG14  
Amino Acid Sequences MVLGKCYVCHEQVKELYCRHCINTSPHLILKHKIELYQIRAFNNELRSQVDDILQSAMDESKEPQDVLGRNLAMLKTAYLKRKTNKYRHKLEQVRDSVEVKAHRAKQLREQIDRDNATKINEPRQLQEHSGTQKSQFDALKPDLLQLQKVLANSKALKFQELVRLFLVRQREHPEFPYTISFQPVINIQHLYRLPQNVIECSLRSMWEFLVLAGKVLLLELPLKEPGTDVLTSLTGIVLTILVLLRNLELVPRDCSDRRALLRSLLRNYDVDKLFYFMVMNKDVETDIKSKAETVINYEVCHSELQTLLQGSSELSVLEQSVDDKWFLVG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.5
3 0.5
4 0.5
5 0.5
6 0.46
7 0.44
8 0.44
9 0.44
10 0.48
11 0.5
12 0.48
13 0.48
14 0.5
15 0.5
16 0.49
17 0.47
18 0.46
19 0.41
20 0.38
21 0.42
22 0.42
23 0.46
24 0.49
25 0.47
26 0.41
27 0.41
28 0.41
29 0.39
30 0.38
31 0.34
32 0.28
33 0.28
34 0.3
35 0.29
36 0.29
37 0.26
38 0.21
39 0.19
40 0.18
41 0.15
42 0.12
43 0.11
44 0.11
45 0.09
46 0.09
47 0.1
48 0.12
49 0.14
50 0.14
51 0.14
52 0.19
53 0.2
54 0.22
55 0.24
56 0.21
57 0.2
58 0.22
59 0.21
60 0.17
61 0.15
62 0.13
63 0.15
64 0.21
65 0.28
66 0.32
67 0.39
68 0.45
69 0.56
70 0.65
71 0.7
72 0.76
73 0.77
74 0.81
75 0.84
76 0.88
77 0.86
78 0.83
79 0.82
80 0.76
81 0.7
82 0.63
83 0.55
84 0.45
85 0.41
86 0.35
87 0.28
88 0.3
89 0.3
90 0.33
91 0.37
92 0.38
93 0.44
94 0.52
95 0.55
96 0.54
97 0.54
98 0.53
99 0.55
100 0.56
101 0.48
102 0.41
103 0.35
104 0.32
105 0.35
106 0.32
107 0.32
108 0.35
109 0.35
110 0.34
111 0.37
112 0.38
113 0.33
114 0.33
115 0.31
116 0.29
117 0.31
118 0.29
119 0.27
120 0.26
121 0.25
122 0.27
123 0.23
124 0.19
125 0.22
126 0.22
127 0.23
128 0.21
129 0.21
130 0.2
131 0.19
132 0.18
133 0.13
134 0.13
135 0.12
136 0.13
137 0.14
138 0.11
139 0.14
140 0.15
141 0.16
142 0.2
143 0.18
144 0.19
145 0.18
146 0.19
147 0.25
148 0.24
149 0.25
150 0.2
151 0.21
152 0.2
153 0.21
154 0.24
155 0.16
156 0.18
157 0.23
158 0.25
159 0.26
160 0.28
161 0.29
162 0.25
163 0.26
164 0.25
165 0.22
166 0.19
167 0.19
168 0.18
169 0.14
170 0.14
171 0.15
172 0.14
173 0.13
174 0.14
175 0.12
176 0.16
177 0.16
178 0.18
179 0.18
180 0.18
181 0.17
182 0.19
183 0.2
184 0.16
185 0.19
186 0.17
187 0.15
188 0.15
189 0.15
190 0.13
191 0.12
192 0.12
193 0.09
194 0.1
195 0.1
196 0.08
197 0.12
198 0.11
199 0.1
200 0.09
201 0.09
202 0.07
203 0.07
204 0.07
205 0.03
206 0.05
207 0.05
208 0.06
209 0.08
210 0.08
211 0.08
212 0.08
213 0.09
214 0.11
215 0.11
216 0.1
217 0.1
218 0.1
219 0.1
220 0.1
221 0.08
222 0.05
223 0.05
224 0.05
225 0.03
226 0.03
227 0.03
228 0.04
229 0.04
230 0.04
231 0.04
232 0.04
233 0.05
234 0.05
235 0.06
236 0.08
237 0.11
238 0.14
239 0.15
240 0.21
241 0.21
242 0.24
243 0.28
244 0.31
245 0.33
246 0.35
247 0.35
248 0.37
249 0.44
250 0.47
251 0.48
252 0.45
253 0.43
254 0.39
255 0.4
256 0.41
257 0.35
258 0.3
259 0.26
260 0.24
261 0.22
262 0.21
263 0.2
264 0.15
265 0.18
266 0.18
267 0.18
268 0.16
269 0.17
270 0.17
271 0.18
272 0.18
273 0.16
274 0.17
275 0.18
276 0.18
277 0.18
278 0.21
279 0.24
280 0.21
281 0.25
282 0.31
283 0.31
284 0.31
285 0.32
286 0.29
287 0.26
288 0.26
289 0.2
290 0.13
291 0.13
292 0.14
293 0.16
294 0.16
295 0.15
296 0.14
297 0.14
298 0.12
299 0.12
300 0.11
301 0.07
302 0.06
303 0.07
304 0.07
305 0.07
306 0.07
307 0.08
308 0.1
309 0.12
310 0.12