Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C7MYG9

Protein Details
Accession A0A0C7MYG9    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
7-33LNENYGSNKPKKSKGKKTGGKQASFKIHydrophilic
NLS Segment(s)
PositionSequence
15-27KPKKSKGKKTGGK
Subcellular Location(s) nucl 24.5, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR018609  Bud13  
Gene Ontology GO:0005681  C:spliceosomal complex  
Pfam View protein in Pfam  
PF09736  Bud13  
Amino Acid Sequences MSIKDYLNENYGSNKPKKSKGKKTGGKQASFKIVDSFTSNDDAVLENDQRTTRTTNPSNKGLKCVGPNEKKGLWKNLNTNEVSERLLSKKVDTTVSSQNPVGIQSAEDVRRQTEAKELEAKKSLENEAETAETVYRDSQGRKIENYHERVSSQAEDEKLRQEQWELELRELNMGEVQKNGLLGILENNKKSVANDTRSDDPFNAFDPAASTTHNANLHFKSPMGRKLYPKMSAENRFQIQPGYRWDGVDRSNGFEQKWFAKQNELNEKKVQSFTLQDDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.49
3 0.57
4 0.68
5 0.73
6 0.79
7 0.81
8 0.86
9 0.87
10 0.91
11 0.92
12 0.9
13 0.87
14 0.81
15 0.76
16 0.74
17 0.66
18 0.57
19 0.5
20 0.41
21 0.35
22 0.32
23 0.28
24 0.21
25 0.22
26 0.21
27 0.17
28 0.17
29 0.16
30 0.14
31 0.16
32 0.16
33 0.13
34 0.16
35 0.16
36 0.17
37 0.18
38 0.22
39 0.23
40 0.31
41 0.39
42 0.46
43 0.51
44 0.59
45 0.65
46 0.61
47 0.61
48 0.55
49 0.51
50 0.46
51 0.48
52 0.5
53 0.49
54 0.52
55 0.52
56 0.52
57 0.56
58 0.56
59 0.58
60 0.54
61 0.53
62 0.57
63 0.59
64 0.61
65 0.54
66 0.51
67 0.44
68 0.39
69 0.34
70 0.26
71 0.21
72 0.17
73 0.2
74 0.18
75 0.17
76 0.19
77 0.2
78 0.22
79 0.21
80 0.24
81 0.3
82 0.32
83 0.32
84 0.29
85 0.28
86 0.25
87 0.24
88 0.21
89 0.12
90 0.09
91 0.08
92 0.12
93 0.13
94 0.14
95 0.14
96 0.14
97 0.16
98 0.16
99 0.15
100 0.18
101 0.18
102 0.19
103 0.27
104 0.28
105 0.28
106 0.33
107 0.33
108 0.27
109 0.28
110 0.27
111 0.19
112 0.19
113 0.17
114 0.13
115 0.13
116 0.11
117 0.1
118 0.09
119 0.07
120 0.07
121 0.06
122 0.07
123 0.08
124 0.09
125 0.13
126 0.18
127 0.19
128 0.2
129 0.23
130 0.29
131 0.34
132 0.38
133 0.36
134 0.32
135 0.31
136 0.31
137 0.3
138 0.23
139 0.18
140 0.15
141 0.15
142 0.15
143 0.16
144 0.18
145 0.17
146 0.17
147 0.16
148 0.14
149 0.14
150 0.15
151 0.22
152 0.2
153 0.2
154 0.21
155 0.21
156 0.21
157 0.2
158 0.17
159 0.11
160 0.11
161 0.1
162 0.09
163 0.09
164 0.08
165 0.08
166 0.08
167 0.06
168 0.05
169 0.05
170 0.09
171 0.15
172 0.18
173 0.18
174 0.19
175 0.19
176 0.19
177 0.2
178 0.24
179 0.25
180 0.27
181 0.31
182 0.35
183 0.4
184 0.41
185 0.43
186 0.35
187 0.3
188 0.26
189 0.24
190 0.22
191 0.16
192 0.14
193 0.14
194 0.15
195 0.13
196 0.13
197 0.13
198 0.12
199 0.17
200 0.2
201 0.2
202 0.22
203 0.24
204 0.25
205 0.24
206 0.24
207 0.26
208 0.29
209 0.34
210 0.37
211 0.4
212 0.43
213 0.51
214 0.57
215 0.57
216 0.54
217 0.55
218 0.57
219 0.59
220 0.6
221 0.59
222 0.54
223 0.49
224 0.47
225 0.44
226 0.38
227 0.36
228 0.36
229 0.36
230 0.35
231 0.35
232 0.36
233 0.36
234 0.34
235 0.38
236 0.32
237 0.3
238 0.36
239 0.37
240 0.36
241 0.34
242 0.36
243 0.33
244 0.39
245 0.39
246 0.34
247 0.42
248 0.45
249 0.51
250 0.59
251 0.59
252 0.56
253 0.57
254 0.59
255 0.54
256 0.53
257 0.45
258 0.37
259 0.37