Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q4WHB1

Protein Details
Accession Q4WHB1    Localization Confidence Low Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
42-62LFQNRVFQRRRLPNRQKFLEDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23, nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001648  Ribosomal_S18  
IPR036870  Ribosomal_S18_sf  
Gene Ontology GO:0005763  C:mitochondrial small ribosomal subunit  
GO:0070181  F:small ribosomal subunit rRNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG afm:AFUA_2G06030  -  
Pfam View protein in Pfam  
PF01084  Ribosomal_S18  
Amino Acid Sequences MVFNILSPLPFRSSGLSLGSFSTCRWSSTLPSKTAHQRPAALFQNRVFQRRRLPNRQKFLEDQKAQGESRALEKFQTRDWKAGDIYAPHDLSPAEMKKWRKRQGPAADAFDALNLNPLDLYKNFSIMSEYMTAMGRIKHRSATGLRPVNQRKIAKAIRRAIGIGLMPSVHRHPEILAAEAKARMEGTPIY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.23
3 0.22
4 0.2
5 0.21
6 0.21
7 0.18
8 0.16
9 0.21
10 0.19
11 0.19
12 0.2
13 0.21
14 0.25
15 0.35
16 0.41
17 0.38
18 0.39
19 0.44
20 0.52
21 0.57
22 0.57
23 0.5
24 0.49
25 0.48
26 0.54
27 0.57
28 0.51
29 0.46
30 0.42
31 0.47
32 0.45
33 0.48
34 0.43
35 0.39
36 0.45
37 0.52
38 0.61
39 0.63
40 0.71
41 0.76
42 0.82
43 0.83
44 0.77
45 0.73
46 0.72
47 0.71
48 0.62
49 0.55
50 0.48
51 0.47
52 0.42
53 0.37
54 0.29
55 0.19
56 0.22
57 0.21
58 0.17
59 0.16
60 0.18
61 0.18
62 0.22
63 0.3
64 0.27
65 0.29
66 0.3
67 0.31
68 0.29
69 0.29
70 0.25
71 0.17
72 0.18
73 0.17
74 0.16
75 0.13
76 0.14
77 0.12
78 0.11
79 0.14
80 0.13
81 0.12
82 0.16
83 0.22
84 0.3
85 0.4
86 0.48
87 0.51
88 0.55
89 0.63
90 0.67
91 0.69
92 0.65
93 0.6
94 0.53
95 0.46
96 0.41
97 0.32
98 0.22
99 0.14
100 0.14
101 0.09
102 0.08
103 0.07
104 0.08
105 0.09
106 0.1
107 0.14
108 0.1
109 0.12
110 0.12
111 0.12
112 0.14
113 0.12
114 0.14
115 0.11
116 0.11
117 0.11
118 0.11
119 0.12
120 0.11
121 0.13
122 0.15
123 0.17
124 0.18
125 0.2
126 0.2
127 0.25
128 0.27
129 0.32
130 0.38
131 0.43
132 0.46
133 0.54
134 0.59
135 0.62
136 0.66
137 0.61
138 0.54
139 0.56
140 0.6
141 0.58
142 0.61
143 0.61
144 0.56
145 0.56
146 0.54
147 0.45
148 0.39
149 0.32
150 0.23
151 0.16
152 0.13
153 0.11
154 0.13
155 0.15
156 0.15
157 0.14
158 0.14
159 0.14
160 0.21
161 0.23
162 0.23
163 0.24
164 0.23
165 0.24
166 0.25
167 0.25
168 0.18
169 0.17
170 0.14