Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D2AGM8

Protein Details
Accession A0A0D2AGM8    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MQGTNLKRNTRKRRERKESAEKVDHTHydrophilic
NLS Segment(s)
PositionSequence
8-17RNTRKRRERK
Subcellular Location(s) mito 18, nucl 5, cyto 4
Family & Domain DBs
Amino Acid Sequences MQGTNLKRNTRKRRERKESAEKVDHTMTAAKSAGKEIEAAAFLVNALAAAAADAEAQAVAAAAVKVTTAGGDTATSGSLDCARHQSGLLDDQLFRRLHTSQKRYWSAWNLSRKERRLTTPNDLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.94
3 0.94
4 0.94
5 0.93
6 0.91
7 0.88
8 0.79
9 0.73
10 0.64
11 0.53
12 0.43
13 0.37
14 0.28
15 0.22
16 0.21
17 0.17
18 0.15
19 0.17
20 0.16
21 0.11
22 0.12
23 0.09
24 0.1
25 0.09
26 0.09
27 0.07
28 0.07
29 0.06
30 0.05
31 0.05
32 0.03
33 0.02
34 0.02
35 0.02
36 0.02
37 0.02
38 0.02
39 0.02
40 0.02
41 0.02
42 0.02
43 0.02
44 0.02
45 0.02
46 0.02
47 0.02
48 0.02
49 0.02
50 0.02
51 0.02
52 0.02
53 0.02
54 0.02
55 0.02
56 0.03
57 0.03
58 0.03
59 0.04
60 0.04
61 0.04
62 0.05
63 0.04
64 0.05
65 0.08
66 0.08
67 0.09
68 0.12
69 0.13
70 0.14
71 0.14
72 0.14
73 0.14
74 0.16
75 0.17
76 0.14
77 0.14
78 0.15
79 0.21
80 0.2
81 0.18
82 0.19
83 0.19
84 0.26
85 0.36
86 0.42
87 0.42
88 0.52
89 0.57
90 0.57
91 0.63
92 0.62
93 0.61
94 0.62
95 0.66
96 0.61
97 0.66
98 0.73
99 0.71
100 0.71
101 0.67
102 0.68
103 0.66
104 0.69