Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D1ZJF4

Protein Details
Accession A0A0D1ZJF4    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
65-87LSGERQKKSKKNRETGLERRKRVBasic
NLS Segment(s)
PositionSequence
69-86RQKKSKKNRETGLERRKR
Subcellular Location(s) nucl 18.5, cyto_nucl 12, cyto 4.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR013892  Cyt_c_biogenesis_Cmc1-like  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
Pfam View protein in Pfam  
PF08583  Cmc1  
Amino Acid Sequences MWAWLEPHDLYWRRVSTKMHSHLHTKDNVGCEEIMNALDECHARGFLYKAVGGCNEIKREVNRCLSGERQKKSKKNRETGLERRKRVEAVWAKMDNGDFSDLEAIINGTEKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.42
3 0.41
4 0.48
5 0.54
6 0.54
7 0.53
8 0.57
9 0.58
10 0.59
11 0.54
12 0.47
13 0.42
14 0.39
15 0.37
16 0.32
17 0.26
18 0.21
19 0.18
20 0.15
21 0.12
22 0.09
23 0.08
24 0.07
25 0.07
26 0.07
27 0.07
28 0.07
29 0.07
30 0.06
31 0.07
32 0.08
33 0.09
34 0.1
35 0.1
36 0.1
37 0.11
38 0.11
39 0.12
40 0.14
41 0.14
42 0.14
43 0.14
44 0.15
45 0.17
46 0.21
47 0.23
48 0.24
49 0.24
50 0.24
51 0.26
52 0.31
53 0.39
54 0.42
55 0.42
56 0.47
57 0.54
58 0.61
59 0.7
60 0.74
61 0.74
62 0.76
63 0.8
64 0.8
65 0.81
66 0.83
67 0.84
68 0.83
69 0.76
70 0.7
71 0.65
72 0.57
73 0.48
74 0.48
75 0.45
76 0.41
77 0.47
78 0.44
79 0.42
80 0.43
81 0.42
82 0.33
83 0.26
84 0.22
85 0.13
86 0.13
87 0.14
88 0.12
89 0.12
90 0.11
91 0.1
92 0.07