Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q4WGP6

Protein Details
Accession Q4WGP6   
Localization Confidence Medium
Confidence Score 14.6
NoLS Segment(s)
PositionSequenceProtein Nature
55-76SAPVNATPRKRGRKKAADGDADHydrophilic
NLS Segment(s)
PositionSequence
63-69RKRGRKK
85-93KKGKTSPKK
Subcellular Location(s) nucl 17, cyto_nucl 13, cyto 7
Family & Domain DBs
KEGG afm:AFUA_7G05770  -  
Amino Acid Sequences MSLDIFTLPDPTGPVLTVSTFTPINTDMDVTEIKVENDQSNNVRPGAAEESQSTSAPVNATPRKRGRKKAADGDADADSTETPAKKGKTSPKKGLGPIPASPESAGLADKMVLRMRDEEGRSWSEITNVWTRMTGIKVEGSTLRKRYTAMKANFISISAEDEARILKVKKEIEEKFEQEKWHKIADSVAADGGNKYPASAIQKKFKELNKRTQAAAAGEAED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.11
3 0.12
4 0.13
5 0.12
6 0.13
7 0.13
8 0.12
9 0.13
10 0.13
11 0.14
12 0.13
13 0.13
14 0.11
15 0.13
16 0.14
17 0.12
18 0.14
19 0.13
20 0.13
21 0.15
22 0.17
23 0.17
24 0.18
25 0.22
26 0.22
27 0.27
28 0.29
29 0.27
30 0.25
31 0.22
32 0.24
33 0.25
34 0.22
35 0.18
36 0.18
37 0.22
38 0.23
39 0.23
40 0.2
41 0.15
42 0.15
43 0.14
44 0.14
45 0.18
46 0.23
47 0.27
48 0.34
49 0.43
50 0.53
51 0.61
52 0.69
53 0.72
54 0.76
55 0.81
56 0.82
57 0.82
58 0.75
59 0.68
60 0.61
61 0.51
62 0.41
63 0.32
64 0.22
65 0.14
66 0.1
67 0.1
68 0.08
69 0.08
70 0.12
71 0.13
72 0.15
73 0.22
74 0.31
75 0.4
76 0.49
77 0.56
78 0.61
79 0.65
80 0.66
81 0.65
82 0.61
83 0.53
84 0.47
85 0.44
86 0.36
87 0.31
88 0.28
89 0.23
90 0.17
91 0.14
92 0.12
93 0.06
94 0.05
95 0.06
96 0.06
97 0.07
98 0.08
99 0.08
100 0.08
101 0.1
102 0.11
103 0.15
104 0.16
105 0.17
106 0.18
107 0.2
108 0.2
109 0.2
110 0.18
111 0.15
112 0.15
113 0.16
114 0.18
115 0.17
116 0.16
117 0.15
118 0.16
119 0.16
120 0.16
121 0.13
122 0.1
123 0.1
124 0.1
125 0.11
126 0.14
127 0.17
128 0.21
129 0.24
130 0.25
131 0.24
132 0.25
133 0.3
134 0.35
135 0.41
136 0.39
137 0.44
138 0.43
139 0.45
140 0.43
141 0.38
142 0.3
143 0.21
144 0.21
145 0.13
146 0.12
147 0.1
148 0.1
149 0.1
150 0.1
151 0.13
152 0.11
153 0.13
154 0.18
155 0.21
156 0.26
157 0.34
158 0.37
159 0.4
160 0.46
161 0.48
162 0.49
163 0.5
164 0.5
165 0.45
166 0.5
167 0.46
168 0.43
169 0.39
170 0.33
171 0.32
172 0.33
173 0.31
174 0.24
175 0.22
176 0.18
177 0.18
178 0.18
179 0.16
180 0.13
181 0.11
182 0.1
183 0.09
184 0.13
185 0.21
186 0.29
187 0.35
188 0.42
189 0.45
190 0.51
191 0.58
192 0.61
193 0.64
194 0.64
195 0.69
196 0.69
197 0.69
198 0.66
199 0.63
200 0.59
201 0.5
202 0.46