Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D1Y4Z1

Protein Details
Accession A0A0D1Y4Z1   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
97-126QASKIEKASRQQRKQRKNRSKEFRGTAKTKHydrophilic
NLS Segment(s)
PositionSequence
101-134IEKASRQQRKQRKNRSKEFRGTAKTKGASKDKKK
Subcellular Location(s) mito 15, nucl 7, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MADSAVTIRTRKFITNRLLARKQFVVDILHPNRPNVSKDDLRAKLAEVYKSNKDQINVFGLRTHYGGGKSTGFALIYDSVEALKKFEPHYRLVRVGQASKIEKASRQQRKQRKNRSKEFRGTAKTKGASKDKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.5
3 0.57
4 0.62
5 0.68
6 0.64
7 0.63
8 0.57
9 0.5
10 0.42
11 0.37
12 0.31
13 0.26
14 0.34
15 0.33
16 0.38
17 0.38
18 0.37
19 0.39
20 0.37
21 0.36
22 0.3
23 0.33
24 0.29
25 0.33
26 0.42
27 0.4
28 0.39
29 0.37
30 0.34
31 0.33
32 0.32
33 0.32
34 0.25
35 0.28
36 0.3
37 0.32
38 0.35
39 0.31
40 0.29
41 0.26
42 0.25
43 0.27
44 0.23
45 0.21
46 0.2
47 0.19
48 0.19
49 0.17
50 0.16
51 0.11
52 0.1
53 0.11
54 0.11
55 0.1
56 0.09
57 0.09
58 0.09
59 0.08
60 0.07
61 0.08
62 0.07
63 0.07
64 0.07
65 0.06
66 0.06
67 0.08
68 0.08
69 0.08
70 0.08
71 0.1
72 0.12
73 0.17
74 0.2
75 0.24
76 0.3
77 0.33
78 0.36
79 0.35
80 0.38
81 0.37
82 0.36
83 0.34
84 0.34
85 0.32
86 0.31
87 0.33
88 0.29
89 0.28
90 0.35
91 0.43
92 0.47
93 0.55
94 0.63
95 0.7
96 0.8
97 0.88
98 0.91
99 0.92
100 0.92
101 0.93
102 0.93
103 0.93
104 0.92
105 0.89
106 0.88
107 0.86
108 0.79
109 0.74
110 0.72
111 0.67
112 0.63
113 0.62
114 0.63