Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2A9G5

Protein Details
Accession A0A0D2A9G5   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
38-68ATCLHMYEKSKKRERKKEKRLHNPPAKIKNTBasic
NLS Segment(s)
PositionSequence
46-64KSKKRERKKEKRLHNPPAK
Subcellular Location(s) mito 8, nucl 7, plas 4, golg 3, pero 2.5, cyto_pero 2.5
Family & Domain DBs
Amino Acid Sequences MDKDVCGIFRTPSIPQPTWVLRPFEQMCDVHVDQSLGATCLHMYEKSKKRERKKEKRLHNPPAKIKNTDWPVLHCTACWSVGRMRELSIYLFGRCTVLCIIPLDTDRQTRTHYLSRTYTYSILYR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.32
3 0.37
4 0.39
5 0.43
6 0.45
7 0.43
8 0.36
9 0.44
10 0.43
11 0.4
12 0.39
13 0.32
14 0.29
15 0.32
16 0.31
17 0.23
18 0.22
19 0.2
20 0.15
21 0.16
22 0.15
23 0.08
24 0.08
25 0.07
26 0.06
27 0.07
28 0.08
29 0.08
30 0.12
31 0.21
32 0.29
33 0.38
34 0.48
35 0.55
36 0.65
37 0.75
38 0.83
39 0.84
40 0.88
41 0.88
42 0.9
43 0.93
44 0.92
45 0.92
46 0.9
47 0.86
48 0.84
49 0.84
50 0.76
51 0.68
52 0.59
53 0.56
54 0.5
55 0.46
56 0.38
57 0.31
58 0.32
59 0.31
60 0.3
61 0.22
62 0.21
63 0.18
64 0.18
65 0.16
66 0.14
67 0.15
68 0.19
69 0.21
70 0.19
71 0.19
72 0.19
73 0.19
74 0.18
75 0.19
76 0.16
77 0.15
78 0.14
79 0.14
80 0.14
81 0.12
82 0.14
83 0.11
84 0.1
85 0.11
86 0.12
87 0.13
88 0.14
89 0.15
90 0.17
91 0.18
92 0.22
93 0.22
94 0.23
95 0.26
96 0.28
97 0.33
98 0.37
99 0.38
100 0.41
101 0.44
102 0.47
103 0.47
104 0.47
105 0.42