Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q4WWW1

Protein Details
Accession Q4WWW1    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
36-56ESNAKHIPVRNLQRRRRLLTSHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 11.833, nucl 11, cyto 8.5, cyto_mito 7.332, mito 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018464  CENP-O  
Gene Ontology GO:0031511  C:Mis6-Sim4 complex  
GO:0005634  C:nucleus  
GO:0034508  P:centromere complex assembly  
KEGG afm:AFUA_3G07280  -  
Pfam View protein in Pfam  
PF09496  CENP-O  
Amino Acid Sequences MRIIACIPQSTVMESPDRLKQVEEQLDSEISSIRRESNAKHIPVRNLQRRRRLLTSSLLSSDNFQKRLKARQAALAPTPISSLSDEVSPLVQAADKHAELNHHRVAFSTTTFPFKDPSPHSDHPNLLGVRIDICCRNGRFTKPYYVLLRRAGTGDEKRLRVHRHTIPAFIPIEKLERVYLPLPPTQDSTEEDAPLKPGKERVRKQDLRGLVRELRRQLVAWHLRVDAVNMLKEDLGGVQDGSVGGVMVESRLEPNDLGIVSVSPTTLEATYVRLEWEDGRVGRFKLSDTGVIERAVIIGDRGRDKRLETVFIGGDGRVETLLDRLRQHIISASGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.25
3 0.28
4 0.3
5 0.27
6 0.27
7 0.3
8 0.36
9 0.42
10 0.41
11 0.37
12 0.37
13 0.37
14 0.35
15 0.3
16 0.24
17 0.17
18 0.17
19 0.16
20 0.16
21 0.19
22 0.22
23 0.25
24 0.32
25 0.4
26 0.43
27 0.5
28 0.54
29 0.56
30 0.63
31 0.71
32 0.71
33 0.73
34 0.76
35 0.78
36 0.81
37 0.81
38 0.78
39 0.72
40 0.66
41 0.65
42 0.62
43 0.54
44 0.49
45 0.43
46 0.37
47 0.35
48 0.39
49 0.36
50 0.34
51 0.31
52 0.35
53 0.38
54 0.48
55 0.54
56 0.52
57 0.48
58 0.53
59 0.57
60 0.55
61 0.53
62 0.47
63 0.39
64 0.31
65 0.3
66 0.22
67 0.18
68 0.14
69 0.13
70 0.09
71 0.1
72 0.1
73 0.09
74 0.09
75 0.08
76 0.07
77 0.06
78 0.07
79 0.07
80 0.1
81 0.13
82 0.13
83 0.14
84 0.15
85 0.2
86 0.22
87 0.28
88 0.29
89 0.26
90 0.26
91 0.26
92 0.28
93 0.24
94 0.22
95 0.21
96 0.17
97 0.2
98 0.21
99 0.21
100 0.2
101 0.2
102 0.26
103 0.25
104 0.29
105 0.34
106 0.37
107 0.41
108 0.44
109 0.43
110 0.38
111 0.41
112 0.35
113 0.26
114 0.24
115 0.19
116 0.16
117 0.16
118 0.15
119 0.1
120 0.12
121 0.16
122 0.16
123 0.21
124 0.23
125 0.27
126 0.31
127 0.32
128 0.38
129 0.36
130 0.4
131 0.42
132 0.43
133 0.42
134 0.42
135 0.4
136 0.33
137 0.31
138 0.27
139 0.25
140 0.23
141 0.27
142 0.27
143 0.27
144 0.28
145 0.33
146 0.36
147 0.34
148 0.39
149 0.37
150 0.41
151 0.41
152 0.42
153 0.38
154 0.38
155 0.35
156 0.27
157 0.23
158 0.14
159 0.15
160 0.13
161 0.13
162 0.09
163 0.09
164 0.11
165 0.11
166 0.13
167 0.13
168 0.15
169 0.16
170 0.16
171 0.18
172 0.17
173 0.18
174 0.17
175 0.2
176 0.19
177 0.19
178 0.19
179 0.17
180 0.18
181 0.18
182 0.16
183 0.12
184 0.18
185 0.25
186 0.35
187 0.4
188 0.48
189 0.57
190 0.61
191 0.64
192 0.65
193 0.63
194 0.58
195 0.55
196 0.51
197 0.46
198 0.46
199 0.47
200 0.42
201 0.37
202 0.33
203 0.3
204 0.27
205 0.3
206 0.32
207 0.28
208 0.28
209 0.26
210 0.26
211 0.26
212 0.26
213 0.19
214 0.15
215 0.15
216 0.13
217 0.13
218 0.12
219 0.12
220 0.11
221 0.08
222 0.06
223 0.05
224 0.05
225 0.04
226 0.05
227 0.05
228 0.05
229 0.04
230 0.03
231 0.03
232 0.03
233 0.03
234 0.03
235 0.03
236 0.04
237 0.04
238 0.05
239 0.06
240 0.06
241 0.07
242 0.09
243 0.09
244 0.09
245 0.08
246 0.08
247 0.07
248 0.08
249 0.07
250 0.05
251 0.06
252 0.07
253 0.07
254 0.08
255 0.08
256 0.1
257 0.11
258 0.11
259 0.12
260 0.11
261 0.12
262 0.12
263 0.14
264 0.17
265 0.16
266 0.19
267 0.22
268 0.22
269 0.23
270 0.23
271 0.22
272 0.21
273 0.23
274 0.24
275 0.24
276 0.27
277 0.27
278 0.27
279 0.25
280 0.2
281 0.18
282 0.14
283 0.11
284 0.08
285 0.09
286 0.13
287 0.2
288 0.22
289 0.25
290 0.26
291 0.29
292 0.36
293 0.37
294 0.38
295 0.32
296 0.35
297 0.33
298 0.32
299 0.31
300 0.23
301 0.2
302 0.15
303 0.14
304 0.09
305 0.09
306 0.08
307 0.12
308 0.17
309 0.2
310 0.21
311 0.23
312 0.28
313 0.28
314 0.29
315 0.29