Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D1XS12

Protein Details
Accession A0A0D1XS12   
Localization Confidence High
Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
83-110EYEERQRLKKSKKKSKDDDKDKKKKDDEBasic
NLS Segment(s)
PositionSequence
69-69K
86-107ERQRLKKSKKKSKDDDKDKKKK
Subcellular Location(s) nucl 19.5, cyto_nucl 12.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013640  Vfa1  
Pfam View protein in Pfam  
PF08432  Vfa1  
Amino Acid Sequences MAAPFPNVYHLRTVAETSSKPCFVCYKPTCKVLITPNNKDFFYTCVGHLNDAGFASPVVDAEAEAAKKKKELMDKEIEKVKQEYEERQRLKKSKKKSKDDDKDKKKKDDEDQDNSKAEKERDEKIKAIQSGGESKDQGDDIARIYALHRNFYQIRLDKLRNLEVAKRNQQRLNTPGFFPSTPKGDLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.26
3 0.26
4 0.26
5 0.3
6 0.3
7 0.28
8 0.28
9 0.31
10 0.28
11 0.38
12 0.41
13 0.44
14 0.47
15 0.52
16 0.52
17 0.47
18 0.51
19 0.5
20 0.53
21 0.53
22 0.57
23 0.59
24 0.6
25 0.59
26 0.55
27 0.45
28 0.38
29 0.34
30 0.26
31 0.2
32 0.24
33 0.24
34 0.24
35 0.24
36 0.21
37 0.17
38 0.15
39 0.15
40 0.08
41 0.07
42 0.07
43 0.06
44 0.05
45 0.05
46 0.04
47 0.04
48 0.05
49 0.07
50 0.07
51 0.09
52 0.11
53 0.11
54 0.12
55 0.14
56 0.17
57 0.23
58 0.28
59 0.33
60 0.42
61 0.44
62 0.47
63 0.52
64 0.48
65 0.42
66 0.38
67 0.31
68 0.26
69 0.26
70 0.29
71 0.32
72 0.4
73 0.42
74 0.46
75 0.52
76 0.54
77 0.63
78 0.62
79 0.64
80 0.66
81 0.73
82 0.78
83 0.81
84 0.85
85 0.86
86 0.91
87 0.91
88 0.91
89 0.92
90 0.88
91 0.86
92 0.79
93 0.75
94 0.72
95 0.72
96 0.69
97 0.67
98 0.68
99 0.63
100 0.61
101 0.54
102 0.48
103 0.4
104 0.33
105 0.31
106 0.27
107 0.3
108 0.35
109 0.38
110 0.38
111 0.39
112 0.44
113 0.38
114 0.35
115 0.3
116 0.25
117 0.27
118 0.28
119 0.26
120 0.2
121 0.19
122 0.2
123 0.18
124 0.16
125 0.12
126 0.11
127 0.09
128 0.1
129 0.1
130 0.08
131 0.1
132 0.15
133 0.15
134 0.18
135 0.17
136 0.22
137 0.23
138 0.26
139 0.33
140 0.32
141 0.38
142 0.42
143 0.45
144 0.44
145 0.48
146 0.5
147 0.45
148 0.44
149 0.46
150 0.46
151 0.53
152 0.58
153 0.62
154 0.65
155 0.65
156 0.67
157 0.66
158 0.64
159 0.64
160 0.57
161 0.51
162 0.47
163 0.47
164 0.42
165 0.39
166 0.37
167 0.32