Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D1XKW8

Protein Details
Accession A0A0D1XKW8   
Localization Confidence Medium
Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
90-109LKKLNKNKKLIKKLARKYDAHydrophilic
NLS Segment(s)
PositionSequence
94-103NKNKKLIKKL
Subcellular Location(s) cyto 10.5, cyto_nucl 9.5, mito 8, nucl 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002143  Ribosomal_L1  
IPR023674  Ribosomal_L1-like  
IPR028364  Ribosomal_L1/biogenesis  
IPR016095  Ribosomal_L1_3-a/b-sand  
IPR023673  Ribosomal_L1_CS  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003723  F:RNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00687  Ribosomal_L1  
PROSITE View protein in PROSITE  
PS01199  RIBOSOMAL_L1  
CDD cd00403  Ribosomal_L1  
Amino Acid Sequences MSKITVAGVRTNVQQLLDYSLNEKKRNFLETVELQIGLKNYDPQRDKRFSGTIKLPTVPRPGMSICVLGDQHDIDRAKHHGVDAMSSDDLKKLNKNKKLIKKLARKYDAFVASDSLIKQIPRLLGPGLSKAGKFPTPISHNEDLAGKITEVKSTIKFQLKKVLCMGVAVGNVGMTEDELISNIMLAINYLVSLLKKGWQNVGSLTIKASMSPPKRLY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.2
3 0.23
4 0.22
5 0.2
6 0.21
7 0.27
8 0.32
9 0.35
10 0.35
11 0.34
12 0.37
13 0.4
14 0.38
15 0.34
16 0.35
17 0.34
18 0.39
19 0.35
20 0.31
21 0.27
22 0.27
23 0.25
24 0.18
25 0.16
26 0.17
27 0.18
28 0.26
29 0.31
30 0.37
31 0.45
32 0.5
33 0.51
34 0.5
35 0.55
36 0.49
37 0.52
38 0.51
39 0.49
40 0.47
41 0.47
42 0.44
43 0.41
44 0.45
45 0.38
46 0.32
47 0.28
48 0.26
49 0.25
50 0.25
51 0.21
52 0.15
53 0.17
54 0.16
55 0.14
56 0.14
57 0.12
58 0.11
59 0.15
60 0.15
61 0.13
62 0.16
63 0.17
64 0.18
65 0.18
66 0.17
67 0.16
68 0.15
69 0.16
70 0.14
71 0.14
72 0.13
73 0.12
74 0.12
75 0.1
76 0.11
77 0.11
78 0.15
79 0.22
80 0.31
81 0.37
82 0.45
83 0.53
84 0.62
85 0.71
86 0.75
87 0.76
88 0.78
89 0.79
90 0.81
91 0.78
92 0.69
93 0.61
94 0.58
95 0.51
96 0.41
97 0.34
98 0.25
99 0.19
100 0.2
101 0.17
102 0.11
103 0.1
104 0.09
105 0.09
106 0.1
107 0.1
108 0.09
109 0.11
110 0.1
111 0.12
112 0.13
113 0.14
114 0.14
115 0.14
116 0.14
117 0.13
118 0.16
119 0.14
120 0.15
121 0.14
122 0.19
123 0.22
124 0.26
125 0.33
126 0.32
127 0.31
128 0.31
129 0.3
130 0.24
131 0.22
132 0.19
133 0.11
134 0.12
135 0.12
136 0.12
137 0.12
138 0.14
139 0.15
140 0.18
141 0.24
142 0.3
143 0.33
144 0.34
145 0.43
146 0.42
147 0.43
148 0.42
149 0.39
150 0.3
151 0.28
152 0.27
153 0.19
154 0.17
155 0.14
156 0.11
157 0.08
158 0.08
159 0.07
160 0.06
161 0.04
162 0.04
163 0.04
164 0.04
165 0.05
166 0.05
167 0.05
168 0.05
169 0.05
170 0.05
171 0.04
172 0.05
173 0.05
174 0.04
175 0.04
176 0.05
177 0.05
178 0.05
179 0.07
180 0.07
181 0.12
182 0.16
183 0.19
184 0.25
185 0.26
186 0.27
187 0.28
188 0.35
189 0.32
190 0.29
191 0.28
192 0.25
193 0.23
194 0.22
195 0.24
196 0.26
197 0.28