Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D1ZYS7

Protein Details
Accession A0A0D1ZYS7   
Localization Confidence Medium
Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
18-42KPDVKATPKSKAKPRAAPKTPTKTPHydrophilic
122-147GVTKSAKKTKQPLKAAKKKPTNENEDHydrophilic
NLS Segment(s)
PositionSequence
22-40KATPKSKAKPRAAPKTPTK
122-140GVTKSAKKTKQPLKAAKKK
Subcellular Location(s) cyto 12, cyto_nucl 9, mito 7, nucl 4, pero 3
Family & Domain DBs
Amino Acid Sequences MADFSPEPVAAATPTTPKPDVKATPKSKAKPRAAPKTPTKTPTKSKDADGLTPREMELLVGALTNLKDDARIQVNYEAMAGATGLKDGNSAKASWAGLRKKLNMTGGIGSTPSAGSPEKPAGVTKSAKKTKQPLKAAKKKPTNENEDNDKVVASSEEPKGEPKGDAGVEGQKDEATDDAVKMEDGKEEREEEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.22
3 0.24
4 0.24
5 0.27
6 0.33
7 0.4
8 0.43
9 0.52
10 0.54
11 0.62
12 0.7
13 0.75
14 0.77
15 0.79
16 0.79
17 0.79
18 0.82
19 0.83
20 0.81
21 0.82
22 0.83
23 0.82
24 0.8
25 0.76
26 0.74
27 0.71
28 0.72
29 0.72
30 0.7
31 0.63
32 0.59
33 0.6
34 0.55
35 0.55
36 0.51
37 0.47
38 0.4
39 0.37
40 0.34
41 0.27
42 0.23
43 0.16
44 0.11
45 0.07
46 0.05
47 0.05
48 0.05
49 0.05
50 0.05
51 0.05
52 0.06
53 0.05
54 0.05
55 0.06
56 0.1
57 0.12
58 0.13
59 0.14
60 0.16
61 0.16
62 0.16
63 0.15
64 0.12
65 0.08
66 0.07
67 0.06
68 0.04
69 0.03
70 0.03
71 0.03
72 0.03
73 0.04
74 0.05
75 0.07
76 0.08
77 0.08
78 0.08
79 0.1
80 0.1
81 0.12
82 0.18
83 0.18
84 0.22
85 0.25
86 0.27
87 0.27
88 0.29
89 0.29
90 0.24
91 0.23
92 0.19
93 0.17
94 0.15
95 0.13
96 0.11
97 0.09
98 0.08
99 0.06
100 0.06
101 0.06
102 0.06
103 0.09
104 0.1
105 0.11
106 0.11
107 0.13
108 0.13
109 0.18
110 0.21
111 0.24
112 0.33
113 0.4
114 0.43
115 0.48
116 0.55
117 0.6
118 0.65
119 0.69
120 0.7
121 0.74
122 0.82
123 0.85
124 0.86
125 0.86
126 0.83
127 0.83
128 0.81
129 0.79
130 0.76
131 0.73
132 0.71
133 0.65
134 0.61
135 0.51
136 0.42
137 0.32
138 0.25
139 0.19
140 0.13
141 0.14
142 0.14
143 0.16
144 0.17
145 0.2
146 0.22
147 0.22
148 0.21
149 0.17
150 0.2
151 0.18
152 0.18
153 0.18
154 0.21
155 0.21
156 0.21
157 0.2
158 0.16
159 0.16
160 0.15
161 0.14
162 0.11
163 0.11
164 0.11
165 0.11
166 0.11
167 0.11
168 0.12
169 0.12
170 0.14
171 0.15
172 0.18
173 0.2