Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D1ZGQ6

Protein Details
Accession A0A0D1ZGQ6   
Localization Confidence Medium
Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
4-30SYLAGTRTNRAKRRRAQNRASQRLFREHydrophilic
NLS Segment(s)
PositionSequence
13-21RAKRRRAQN
Subcellular Location(s) nucl 18.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
Pfam View protein in Pfam  
PF00170  bZIP_1  
PROSITE View protein in PROSITE  
PS50217  BZIP  
CDD cd14688  bZIP_YAP  
Amino Acid Sequences MGISYLAGTRTNRAKRRRAQNRASQRLFRERKLQYVKGIETQLEELNEKYQDLLVSFKIQADDNAELRSRIAKLNNTSLPNYSWKGRYT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.66
3 0.77
4 0.83
5 0.84
6 0.84
7 0.86
8 0.89
9 0.9
10 0.86
11 0.8
12 0.75
13 0.75
14 0.7
15 0.63
16 0.61
17 0.52
18 0.56
19 0.57
20 0.54
21 0.49
22 0.49
23 0.48
24 0.42
25 0.41
26 0.32
27 0.25
28 0.24
29 0.19
30 0.15
31 0.14
32 0.1
33 0.1
34 0.1
35 0.09
36 0.08
37 0.07
38 0.07
39 0.07
40 0.08
41 0.08
42 0.1
43 0.1
44 0.11
45 0.11
46 0.11
47 0.11
48 0.14
49 0.16
50 0.15
51 0.17
52 0.17
53 0.16
54 0.16
55 0.18
56 0.15
57 0.17
58 0.2
59 0.25
60 0.29
61 0.38
62 0.44
63 0.44
64 0.45
65 0.43
66 0.41
67 0.41
68 0.39
69 0.36