Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D1Z8K5

Protein Details
Accession A0A0D1Z8K5    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
173-195LHPMARQEERKRRDREKAAELEQBasic
NLS Segment(s)
PositionSequence
119-133KRGGRGGRDRPGGNA
Subcellular Location(s) nucl 16, mito 6, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013170  mRNA_splic_Cwf21_dom  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF08312  cwf21  
CDD cd21372  cwf21_CWC21-like  
Amino Acid Sequences MSSNVGLSTPRGSGTSGYVQRNLSLLKPRDVGVGAPYSMADRDRAPVQRKPDEQILQHDRLREIEVKVLEYRDKVEEENEDEGVDTGNGKREKLTEEDLDELVDKKRAELIADMERADKRGGRGGRDRPGGNATGKNLKKYQVHELAEAKEKESEKLRRALGLKGDQLGEDGLHPMARQEERKRRDREKAAELEQQADHDDDGT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.25
3 0.3
4 0.32
5 0.35
6 0.35
7 0.35
8 0.36
9 0.33
10 0.28
11 0.31
12 0.31
13 0.32
14 0.33
15 0.33
16 0.33
17 0.32
18 0.28
19 0.22
20 0.21
21 0.17
22 0.15
23 0.15
24 0.13
25 0.13
26 0.13
27 0.11
28 0.09
29 0.12
30 0.18
31 0.25
32 0.29
33 0.33
34 0.4
35 0.47
36 0.49
37 0.5
38 0.54
39 0.51
40 0.48
41 0.53
42 0.52
43 0.49
44 0.49
45 0.46
46 0.38
47 0.35
48 0.36
49 0.29
50 0.23
51 0.22
52 0.21
53 0.21
54 0.22
55 0.22
56 0.2
57 0.17
58 0.18
59 0.16
60 0.16
61 0.14
62 0.15
63 0.15
64 0.17
65 0.18
66 0.16
67 0.14
68 0.13
69 0.12
70 0.11
71 0.09
72 0.06
73 0.05
74 0.11
75 0.12
76 0.12
77 0.12
78 0.13
79 0.15
80 0.18
81 0.21
82 0.16
83 0.17
84 0.19
85 0.18
86 0.17
87 0.16
88 0.14
89 0.1
90 0.12
91 0.1
92 0.09
93 0.11
94 0.1
95 0.11
96 0.11
97 0.14
98 0.16
99 0.17
100 0.17
101 0.17
102 0.17
103 0.18
104 0.17
105 0.14
106 0.11
107 0.17
108 0.18
109 0.21
110 0.29
111 0.34
112 0.4
113 0.44
114 0.43
115 0.39
116 0.39
117 0.37
118 0.33
119 0.28
120 0.24
121 0.29
122 0.3
123 0.32
124 0.31
125 0.34
126 0.35
127 0.36
128 0.43
129 0.42
130 0.43
131 0.43
132 0.45
133 0.43
134 0.46
135 0.43
136 0.35
137 0.31
138 0.3
139 0.28
140 0.33
141 0.37
142 0.34
143 0.39
144 0.39
145 0.4
146 0.42
147 0.43
148 0.42
149 0.41
150 0.39
151 0.35
152 0.34
153 0.29
154 0.27
155 0.23
156 0.16
157 0.11
158 0.1
159 0.08
160 0.08
161 0.08
162 0.08
163 0.13
164 0.17
165 0.24
166 0.33
167 0.44
168 0.51
169 0.61
170 0.69
171 0.73
172 0.8
173 0.82
174 0.8
175 0.8
176 0.8
177 0.77
178 0.76
179 0.68
180 0.62
181 0.52
182 0.45
183 0.37
184 0.29