Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D1Y3H6

Protein Details
Accession A0A0D1Y3H6    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
63-89TQLARRLQRLRLQRRRLRRNRSLETIPHydrophilic
NLS Segment(s)
PositionSequence
50-83RGRPRSRSLNRKATQLARRLQRLRLQRRRLRRNR
Subcellular Location(s) nucl 13, cyto_nucl 9.5, mito 8, cyto 4
Family & Domain DBs
Amino Acid Sequences MARRWVGGLFCPCDPFIAAKTLCKKALYLCVVLLDSKGDKPEPPTIPEQRGRPRSRSLNRKATQLARRLQRLRLQRRRLRRNRSLETIPEEDDIPSASLQAPAPIIPSEDDSPDTSSSDQVSQSPESVSISASPSHSFSSQSESAIESPRSDSESESESVAHSHSDADEPSAASSPAAHLQIFETEHLAIVIATGRRAEEAVAEPTQRRPETVPDQRPEQARDIGQGQSTEQVVATGQDQQQTERGTVTLVVQSARVTHSDESVEGRGSDPLLEVTTPQKTEAVTFTKERGIHANRLSPSSPGQEGPEDFEDFDFD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.24
3 0.2
4 0.25
5 0.24
6 0.29
7 0.37
8 0.41
9 0.42
10 0.4
11 0.39
12 0.36
13 0.44
14 0.41
15 0.35
16 0.3
17 0.3
18 0.3
19 0.29
20 0.24
21 0.18
22 0.15
23 0.15
24 0.18
25 0.17
26 0.18
27 0.22
28 0.31
29 0.31
30 0.34
31 0.41
32 0.45
33 0.52
34 0.55
35 0.59
36 0.61
37 0.68
38 0.69
39 0.66
40 0.67
41 0.7
42 0.75
43 0.77
44 0.77
45 0.78
46 0.74
47 0.76
48 0.73
49 0.72
50 0.69
51 0.67
52 0.65
53 0.61
54 0.68
55 0.65
56 0.64
57 0.62
58 0.65
59 0.68
60 0.71
61 0.74
62 0.74
63 0.81
64 0.86
65 0.9
66 0.89
67 0.88
68 0.88
69 0.84
70 0.83
71 0.78
72 0.71
73 0.67
74 0.59
75 0.51
76 0.41
77 0.35
78 0.27
79 0.22
80 0.18
81 0.12
82 0.09
83 0.08
84 0.08
85 0.09
86 0.08
87 0.09
88 0.08
89 0.08
90 0.09
91 0.08
92 0.09
93 0.08
94 0.11
95 0.11
96 0.11
97 0.13
98 0.13
99 0.15
100 0.15
101 0.15
102 0.13
103 0.13
104 0.13
105 0.13
106 0.12
107 0.11
108 0.14
109 0.13
110 0.13
111 0.13
112 0.12
113 0.11
114 0.11
115 0.1
116 0.08
117 0.09
118 0.09
119 0.1
120 0.1
121 0.11
122 0.12
123 0.12
124 0.12
125 0.12
126 0.17
127 0.17
128 0.17
129 0.16
130 0.16
131 0.17
132 0.18
133 0.18
134 0.12
135 0.12
136 0.12
137 0.13
138 0.13
139 0.12
140 0.1
141 0.12
142 0.12
143 0.12
144 0.11
145 0.1
146 0.1
147 0.09
148 0.08
149 0.05
150 0.05
151 0.05
152 0.06
153 0.06
154 0.06
155 0.06
156 0.07
157 0.07
158 0.07
159 0.07
160 0.06
161 0.06
162 0.06
163 0.08
164 0.08
165 0.08
166 0.07
167 0.08
168 0.1
169 0.11
170 0.1
171 0.09
172 0.08
173 0.08
174 0.08
175 0.07
176 0.05
177 0.04
178 0.06
179 0.05
180 0.06
181 0.06
182 0.06
183 0.06
184 0.07
185 0.07
186 0.06
187 0.08
188 0.11
189 0.12
190 0.14
191 0.14
192 0.18
193 0.23
194 0.22
195 0.21
196 0.2
197 0.26
198 0.34
199 0.44
200 0.49
201 0.46
202 0.5
203 0.53
204 0.55
205 0.51
206 0.45
207 0.39
208 0.31
209 0.3
210 0.29
211 0.26
212 0.23
213 0.2
214 0.17
215 0.15
216 0.15
217 0.13
218 0.1
219 0.09
220 0.08
221 0.08
222 0.08
223 0.11
224 0.12
225 0.16
226 0.16
227 0.17
228 0.21
229 0.22
230 0.22
231 0.18
232 0.17
233 0.13
234 0.14
235 0.14
236 0.12
237 0.11
238 0.11
239 0.11
240 0.11
241 0.11
242 0.12
243 0.12
244 0.13
245 0.13
246 0.14
247 0.15
248 0.16
249 0.18
250 0.19
251 0.19
252 0.16
253 0.16
254 0.15
255 0.14
256 0.13
257 0.1
258 0.1
259 0.1
260 0.09
261 0.1
262 0.13
263 0.17
264 0.17
265 0.18
266 0.18
267 0.17
268 0.19
269 0.24
270 0.25
271 0.25
272 0.26
273 0.28
274 0.32
275 0.33
276 0.33
277 0.37
278 0.37
279 0.41
280 0.44
281 0.49
282 0.46
283 0.5
284 0.48
285 0.42
286 0.4
287 0.37
288 0.34
289 0.28
290 0.29
291 0.3
292 0.3
293 0.33
294 0.33
295 0.29
296 0.28