Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D1X1G0

Protein Details
Accession A0A0D1X1G0   
Localization Confidence Medium
Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
21-49VNVPKTRRTYCKGKTCKKHTQHKVTQYKAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto 5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MAHARPDQDRALTDTNSRIQVNVPKTRRTYCKGKTCKKHTQHKVTQYKAGKASLFAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKVVLRLECTQCKTKAQLSLKRCKHFELGGDKKTKGAALVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.33
3 0.34
4 0.32
5 0.27
6 0.26
7 0.32
8 0.37
9 0.42
10 0.42
11 0.45
12 0.49
13 0.56
14 0.59
15 0.57
16 0.6
17 0.6
18 0.67
19 0.71
20 0.76
21 0.8
22 0.82
23 0.87
24 0.86
25 0.87
26 0.87
27 0.87
28 0.86
29 0.86
30 0.87
31 0.79
32 0.78
33 0.71
34 0.66
35 0.57
36 0.51
37 0.4
38 0.32
39 0.3
40 0.3
41 0.29
42 0.25
43 0.31
44 0.34
45 0.38
46 0.43
47 0.47
48 0.43
49 0.5
50 0.57
51 0.54
52 0.56
53 0.55
54 0.55
55 0.54
56 0.57
57 0.49
58 0.44
59 0.41
60 0.34
61 0.37
62 0.39
63 0.38
64 0.33
65 0.4
66 0.44
67 0.53
68 0.61
69 0.64
70 0.63
71 0.67
72 0.74
73 0.74
74 0.73
75 0.7
76 0.66
77 0.65
78 0.67
79 0.65
80 0.6
81 0.57
82 0.52
83 0.47
84 0.46
85 0.43
86 0.43
87 0.47
88 0.52
89 0.54
90 0.63
91 0.69
92 0.72
93 0.7
94 0.64
95 0.6
96 0.54
97 0.54
98 0.54
99 0.54
100 0.55
101 0.58
102 0.54
103 0.51
104 0.49
105 0.42