Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D1WIZ1

Protein Details
Accession A0A0D1WIZ1   
Localization Confidence Low
Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
118-143SEEHPAKKQKCPAKPNKKTKAAPVMAHydrophilic
NLS Segment(s)
PositionSequence
130-135AKPNKK
Subcellular Location(s) cyto 17, mito 4, nucl 3, pero 3
Family & Domain DBs
Amino Acid Sequences MPMTWDENADARLFAGLLTTHDITVDYKKLAAFMGNGKNPPLVPFTLIVKYESNISITLGCTPKAITHRISKIRSIAKTIINTGNDNGMGTATAATPTPTPTGKRGYTKATTAAKPDSEEHPAKKQKCPAKPNKKTKAAPVMAKIEDGDDEDFEHDNNNHDNWNGNFIKAEN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.07
4 0.08
5 0.12
6 0.13
7 0.12
8 0.12
9 0.13
10 0.14
11 0.17
12 0.18
13 0.14
14 0.15
15 0.15
16 0.16
17 0.15
18 0.15
19 0.13
20 0.18
21 0.25
22 0.27
23 0.28
24 0.28
25 0.29
26 0.28
27 0.28
28 0.23
29 0.16
30 0.14
31 0.15
32 0.17
33 0.19
34 0.2
35 0.2
36 0.18
37 0.17
38 0.18
39 0.17
40 0.15
41 0.12
42 0.12
43 0.1
44 0.1
45 0.14
46 0.13
47 0.13
48 0.12
49 0.12
50 0.14
51 0.17
52 0.19
53 0.18
54 0.24
55 0.31
56 0.38
57 0.4
58 0.39
59 0.42
60 0.46
61 0.43
62 0.41
63 0.37
64 0.34
65 0.33
66 0.33
67 0.31
68 0.26
69 0.26
70 0.22
71 0.19
72 0.15
73 0.14
74 0.1
75 0.06
76 0.05
77 0.04
78 0.04
79 0.03
80 0.04
81 0.04
82 0.05
83 0.05
84 0.06
85 0.08
86 0.09
87 0.11
88 0.13
89 0.19
90 0.22
91 0.26
92 0.28
93 0.33
94 0.34
95 0.34
96 0.38
97 0.38
98 0.36
99 0.35
100 0.35
101 0.3
102 0.29
103 0.3
104 0.26
105 0.27
106 0.3
107 0.29
108 0.36
109 0.44
110 0.45
111 0.49
112 0.54
113 0.56
114 0.61
115 0.69
116 0.71
117 0.74
118 0.82
119 0.87
120 0.89
121 0.91
122 0.85
123 0.83
124 0.82
125 0.77
126 0.72
127 0.67
128 0.63
129 0.54
130 0.51
131 0.42
132 0.31
133 0.25
134 0.22
135 0.17
136 0.11
137 0.11
138 0.12
139 0.12
140 0.12
141 0.15
142 0.13
143 0.15
144 0.18
145 0.18
146 0.18
147 0.18
148 0.23
149 0.21
150 0.29
151 0.27
152 0.25