Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D1Z2N9

Protein Details
Accession A0A0D1Z2N9    Localization Confidence Low Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
89-108WARSRYPPLIHPRRDRIQFRHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22, nucl 2, plas 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR018450  Romo1/Mgr2  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF10247  Romo1  
Amino Acid Sequences MPPMPPSAQRRGPSWVDKLKMGMLMGGTVGGIMGLIYGTVTVFQYGGGQAGVMRTLGKYMVGSGATFSVFMGIGSLIRTDCPQTASSVWARSRYPPLIHPRRDRIQFR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.54
3 0.49
4 0.48
5 0.46
6 0.41
7 0.36
8 0.29
9 0.22
10 0.14
11 0.11
12 0.1
13 0.08
14 0.06
15 0.04
16 0.04
17 0.03
18 0.02
19 0.02
20 0.02
21 0.02
22 0.02
23 0.02
24 0.02
25 0.02
26 0.03
27 0.03
28 0.03
29 0.03
30 0.03
31 0.04
32 0.04
33 0.05
34 0.04
35 0.04
36 0.04
37 0.04
38 0.04
39 0.04
40 0.04
41 0.03
42 0.04
43 0.04
44 0.04
45 0.04
46 0.04
47 0.05
48 0.05
49 0.05
50 0.06
51 0.06
52 0.06
53 0.06
54 0.05
55 0.05
56 0.04
57 0.04
58 0.04
59 0.04
60 0.04
61 0.05
62 0.05
63 0.05
64 0.05
65 0.07
66 0.08
67 0.09
68 0.11
69 0.11
70 0.14
71 0.15
72 0.18
73 0.21
74 0.25
75 0.27
76 0.28
77 0.29
78 0.31
79 0.38
80 0.39
81 0.39
82 0.41
83 0.5
84 0.56
85 0.64
86 0.68
87 0.7
88 0.74