Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D1WY78

Protein Details
Accession A0A0D1WY78   
Localization Confidence Medium
Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
10-38AASQQKPQTPQPQQKAKPQPQPLNKPSSAHydrophilic
309-360PKQQAASPKPSQPKKKPAKLEPRSTGLTSPSNPSAARRKPPKLETRSKPATVHydrophilic
NLS Segment(s)
PositionSequence
300-354RPPSKPPAPPKQQAASPKPSQPKKKPAKLEPRSTGLTSPSNPSAARRKPPKLETR
Subcellular Location(s) nucl 12, mito 6, plas 5, cyto 2
Family & Domain DBs
Amino Acid Sequences MPPKKLPPRAASQQKPQTPQPQQKAKPQPQPLNKPSSAPKPQPKNASSPPTAQPAIPEHEIKQSSSMSAQLALEAAKKAYELRQAAYGAGDPNAREEILAKAVNKEIEAETFGKAAKYTRSGAFQGLAAGAGLGVQPGVTLGKLTGALVGGVLASAGAVLGGGIGSAYGAISGPFWDLGQMASRGVRSIVGDFPNWEATSSQKKALEKMVIGAQQTEAPSQQELEEMRDDDGGLGQEDYQQWATDLTSYLPNMPSMPSMPSVPSLPSMPGLWGQSKSNDPPQRPDQSKNASTSKQTQPSRPPSKPPAPPKQQAASPKPSQPKKKPAKLEPRSTGLTSPSNPSAARRKPPKLETRSKPATVNA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.79
3 0.77
4 0.77
5 0.77
6 0.79
7 0.79
8 0.8
9 0.78
10 0.83
11 0.86
12 0.85
13 0.85
14 0.85
15 0.85
16 0.85
17 0.89
18 0.86
19 0.84
20 0.76
21 0.71
22 0.68
23 0.68
24 0.67
25 0.65
26 0.68
27 0.69
28 0.75
29 0.79
30 0.75
31 0.74
32 0.73
33 0.72
34 0.66
35 0.61
36 0.58
37 0.55
38 0.52
39 0.43
40 0.38
41 0.34
42 0.36
43 0.34
44 0.32
45 0.27
46 0.34
47 0.35
48 0.32
49 0.31
50 0.26
51 0.24
52 0.22
53 0.22
54 0.15
55 0.16
56 0.15
57 0.12
58 0.12
59 0.11
60 0.12
61 0.11
62 0.1
63 0.08
64 0.09
65 0.1
66 0.13
67 0.2
68 0.19
69 0.2
70 0.24
71 0.24
72 0.24
73 0.23
74 0.21
75 0.15
76 0.15
77 0.14
78 0.11
79 0.12
80 0.13
81 0.12
82 0.1
83 0.1
84 0.11
85 0.14
86 0.16
87 0.15
88 0.16
89 0.18
90 0.18
91 0.17
92 0.17
93 0.14
94 0.12
95 0.15
96 0.14
97 0.13
98 0.13
99 0.13
100 0.11
101 0.11
102 0.12
103 0.12
104 0.14
105 0.17
106 0.18
107 0.21
108 0.23
109 0.23
110 0.22
111 0.19
112 0.17
113 0.13
114 0.11
115 0.07
116 0.06
117 0.04
118 0.04
119 0.03
120 0.02
121 0.02
122 0.02
123 0.02
124 0.02
125 0.03
126 0.03
127 0.03
128 0.03
129 0.04
130 0.04
131 0.04
132 0.05
133 0.04
134 0.04
135 0.04
136 0.04
137 0.03
138 0.03
139 0.03
140 0.02
141 0.02
142 0.02
143 0.01
144 0.01
145 0.01
146 0.01
147 0.01
148 0.01
149 0.01
150 0.01
151 0.01
152 0.01
153 0.01
154 0.01
155 0.02
156 0.02
157 0.02
158 0.02
159 0.03
160 0.03
161 0.03
162 0.03
163 0.04
164 0.04
165 0.04
166 0.06
167 0.06
168 0.06
169 0.06
170 0.07
171 0.07
172 0.07
173 0.07
174 0.06
175 0.07
176 0.1
177 0.11
178 0.11
179 0.11
180 0.13
181 0.14
182 0.13
183 0.12
184 0.09
185 0.12
186 0.19
187 0.2
188 0.22
189 0.24
190 0.25
191 0.26
192 0.3
193 0.29
194 0.21
195 0.22
196 0.22
197 0.21
198 0.2
199 0.19
200 0.15
201 0.14
202 0.14
203 0.13
204 0.1
205 0.09
206 0.09
207 0.09
208 0.09
209 0.09
210 0.09
211 0.11
212 0.12
213 0.12
214 0.12
215 0.12
216 0.12
217 0.1
218 0.1
219 0.08
220 0.07
221 0.06
222 0.05
223 0.08
224 0.08
225 0.1
226 0.09
227 0.09
228 0.09
229 0.09
230 0.09
231 0.08
232 0.08
233 0.08
234 0.1
235 0.1
236 0.12
237 0.12
238 0.12
239 0.12
240 0.12
241 0.11
242 0.1
243 0.12
244 0.11
245 0.12
246 0.12
247 0.13
248 0.14
249 0.13
250 0.14
251 0.13
252 0.12
253 0.13
254 0.12
255 0.12
256 0.13
257 0.15
258 0.16
259 0.16
260 0.17
261 0.19
262 0.23
263 0.26
264 0.34
265 0.38
266 0.38
267 0.44
268 0.5
269 0.57
270 0.58
271 0.59
272 0.59
273 0.61
274 0.63
275 0.62
276 0.6
277 0.53
278 0.53
279 0.56
280 0.56
281 0.56
282 0.56
283 0.58
284 0.61
285 0.69
286 0.74
287 0.71
288 0.71
289 0.71
290 0.76
291 0.78
292 0.78
293 0.78
294 0.77
295 0.8
296 0.78
297 0.74
298 0.71
299 0.71
300 0.69
301 0.67
302 0.63
303 0.65
304 0.68
305 0.72
306 0.76
307 0.76
308 0.79
309 0.82
310 0.86
311 0.88
312 0.88
313 0.9
314 0.89
315 0.9
316 0.86
317 0.81
318 0.76
319 0.68
320 0.6
321 0.53
322 0.49
323 0.41
324 0.4
325 0.36
326 0.34
327 0.33
328 0.36
329 0.42
330 0.44
331 0.52
332 0.56
333 0.63
334 0.7
335 0.79
336 0.84
337 0.84
338 0.86
339 0.85
340 0.85
341 0.85
342 0.79