Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D2A683

Protein Details
Accession A0A0D2A683    Localization Confidence High Confidence Score 18.9
NoLS Segment(s)
PositionSequenceProtein Nature
20-44ATGARLKKSTKSKNIKLKLRGKRFLHydrophilic
NLS Segment(s)
PositionSequence
16-42RRKDATGARLKKSTKSKNIKLKLRGKR
71-81IGKKNKKPKKD
Subcellular Location(s) nucl 24, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002675  Ribosomal_L38e  
IPR038464  Ribosomal_L38e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01781  Ribosomal_L38e  
Amino Acid Sequences MPSEVTDIKQFLEIARRKDATGARLKKSTKSKNIKLKLRGKRFLYTLNLKDADKADKIKQSLPPKMPFQEIGKKNKKPKKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.35
3 0.35
4 0.34
5 0.39
6 0.41
7 0.38
8 0.44
9 0.46
10 0.43
11 0.49
12 0.5
13 0.52
14 0.59
15 0.61
16 0.61
17 0.64
18 0.69
19 0.73
20 0.81
21 0.82
22 0.81
23 0.82
24 0.81
25 0.8
26 0.78
27 0.71
28 0.65
29 0.59
30 0.54
31 0.5
32 0.47
33 0.4
34 0.38
35 0.37
36 0.33
37 0.33
38 0.3
39 0.27
40 0.23
41 0.25
42 0.24
43 0.27
44 0.29
45 0.31
46 0.38
47 0.43
48 0.49
49 0.52
50 0.54
51 0.54
52 0.56
53 0.55
54 0.51
55 0.49
56 0.51
57 0.51
58 0.56
59 0.61
60 0.66
61 0.74