Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9VDC5

Protein Details
Accession A0A0C9VDC5    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
47-73PPATSSPRSIKKKPSRKKTHVFATKAEHydrophilic
NLS Segment(s)
PositionSequence
53-64PRSIKKKPSRKK
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MSSSGASDELSGLLRVAGDDMTITYQNKTFGTLQPRQARNSTPAPSPPATSSPRSIKKKPSRKKTHVFATKAEQLAVGKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.06
3 0.07
4 0.06
5 0.04
6 0.04
7 0.05
8 0.07
9 0.09
10 0.09
11 0.1
12 0.11
13 0.13
14 0.13
15 0.15
16 0.15
17 0.18
18 0.25
19 0.29
20 0.35
21 0.43
22 0.45
23 0.44
24 0.45
25 0.42
26 0.39
27 0.4
28 0.34
29 0.27
30 0.27
31 0.29
32 0.28
33 0.28
34 0.25
35 0.25
36 0.26
37 0.27
38 0.3
39 0.34
40 0.43
41 0.49
42 0.52
43 0.58
44 0.65
45 0.74
46 0.79
47 0.81
48 0.83
49 0.86
50 0.9
51 0.89
52 0.89
53 0.88
54 0.81
55 0.75
56 0.72
57 0.69
58 0.6
59 0.51
60 0.42