Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9TW90

Protein Details
Accession A0A0C9TW90    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
109-128VSFIIMRYRQIQRKKRKNGRHydrophilic
NLS Segment(s)
PositionSequence
121-128RKKRKNGR
Subcellular Location(s) nucl 16, cyto 5.5, cyto_mito 4.5, mito 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR046528  DUF6593  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF20236  DUF6593  
Amino Acid Sequences MEGAQDLAELHWETVTFDSANLYYRGQQCRMADFLLKNGVFSRSRTFEGSNGMEYKWKCDARGKFTLFDSSRNLLVESHKSHLGILRKARDYSLDVMPAGIPILDDIIVSFIIMRYRQIQRKKRKNGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.13
3 0.1
4 0.09
5 0.11
6 0.11
7 0.14
8 0.14
9 0.14
10 0.18
11 0.24
12 0.28
13 0.29
14 0.33
15 0.32
16 0.34
17 0.35
18 0.3
19 0.28
20 0.24
21 0.25
22 0.27
23 0.25
24 0.22
25 0.21
26 0.24
27 0.21
28 0.22
29 0.25
30 0.21
31 0.23
32 0.25
33 0.25
34 0.23
35 0.27
36 0.26
37 0.23
38 0.21
39 0.19
40 0.21
41 0.2
42 0.22
43 0.23
44 0.22
45 0.21
46 0.28
47 0.32
48 0.34
49 0.43
50 0.42
51 0.37
52 0.37
53 0.43
54 0.36
55 0.34
56 0.31
57 0.25
58 0.24
59 0.22
60 0.22
61 0.15
62 0.17
63 0.2
64 0.18
65 0.19
66 0.19
67 0.19
68 0.19
69 0.22
70 0.25
71 0.26
72 0.29
73 0.33
74 0.35
75 0.35
76 0.35
77 0.34
78 0.31
79 0.3
80 0.27
81 0.22
82 0.19
83 0.19
84 0.19
85 0.16
86 0.13
87 0.09
88 0.06
89 0.04
90 0.05
91 0.04
92 0.04
93 0.04
94 0.05
95 0.05
96 0.05
97 0.05
98 0.06
99 0.08
100 0.09
101 0.11
102 0.17
103 0.26
104 0.35
105 0.45
106 0.54
107 0.63
108 0.74