Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9VGP3

Protein Details
Accession A0A0C9VGP3    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
48-73AATSSPRSIKKKPSRKKTHVFTTKAEHydrophilic
NLS Segment(s)
PositionSequence
54-64RSIKKKPSRKK
Subcellular Location(s) nucl 23, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MSSSGASDELSELLRVAGDDMIIAYQNKTFDTLQPRQAHNSTPAPSPAATSSPRSIKKKPSRKKTHVFTTKAEQLAMGKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.07
4 0.06
5 0.05
6 0.05
7 0.05
8 0.05
9 0.06
10 0.06
11 0.06
12 0.07
13 0.08
14 0.08
15 0.11
16 0.11
17 0.14
18 0.22
19 0.25
20 0.32
21 0.36
22 0.38
23 0.39
24 0.4
25 0.37
26 0.34
27 0.34
28 0.28
29 0.24
30 0.24
31 0.21
32 0.2
33 0.19
34 0.16
35 0.15
36 0.15
37 0.17
38 0.2
39 0.26
40 0.34
41 0.38
42 0.42
43 0.5
44 0.59
45 0.67
46 0.74
47 0.78
48 0.81
49 0.86
50 0.91
51 0.89
52 0.9
53 0.89
54 0.83
55 0.77
56 0.75
57 0.72
58 0.63
59 0.54
60 0.44