Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9V921

Protein Details
Accession A0A0C9V921   
Localization Confidence Medium
Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
29-56LKLPPSQRAHTQKRRRKHIKTLTVPSQRHydrophilic
NLS Segment(s)
PositionSequence
41-46KRRRKH
Subcellular Location(s) nucl 13, mito 11, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences AIHYSDKNHSHSSFNTSSLNTITCLPPSLKLPPSQRAHTQKRRRKHIKTLTVPSQRVALIEKVLLLKKHRSSGIRDRSDHALYSILIYFGFHRHPTSGRNCNIHA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.35
3 0.3
4 0.29
5 0.26
6 0.25
7 0.18
8 0.18
9 0.16
10 0.14
11 0.15
12 0.14
13 0.15
14 0.17
15 0.21
16 0.22
17 0.27
18 0.32
19 0.39
20 0.43
21 0.45
22 0.51
23 0.56
24 0.64
25 0.68
26 0.73
27 0.73
28 0.77
29 0.84
30 0.86
31 0.83
32 0.84
33 0.84
34 0.83
35 0.84
36 0.82
37 0.8
38 0.78
39 0.7
40 0.6
41 0.51
42 0.4
43 0.32
44 0.26
45 0.17
46 0.1
47 0.1
48 0.1
49 0.11
50 0.12
51 0.14
52 0.15
53 0.21
54 0.23
55 0.27
56 0.3
57 0.31
58 0.37
59 0.46
60 0.54
61 0.54
62 0.54
63 0.53
64 0.54
65 0.53
66 0.46
67 0.36
68 0.27
69 0.2
70 0.2
71 0.17
72 0.12
73 0.1
74 0.1
75 0.1
76 0.11
77 0.14
78 0.14
79 0.15
80 0.18
81 0.21
82 0.28
83 0.36
84 0.43
85 0.47