Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9VPK4

Protein Details
Accession A0A0C9VPK4    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
95-114YLKPSLKSQQHKNYARERIPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 8, plas 7, nucl 5.5, cyto_nucl 4, E.R. 2, cyto 1.5
Family & Domain DBs
Amino Acid Sequences MHSLWKRSTVGANKDISQPLRPTSNKLGHTPSSTIVSLISSWSPLPALSPMKGVRRCNHPVSLSSRCFVLCVCFPVVLAVENVNNLLSCGFITLYLKPSLKSQQHKNYARERIPFSEFPR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.51
3 0.44
4 0.4
5 0.36
6 0.33
7 0.38
8 0.37
9 0.39
10 0.43
11 0.48
12 0.47
13 0.48
14 0.5
15 0.45
16 0.47
17 0.42
18 0.35
19 0.31
20 0.28
21 0.24
22 0.18
23 0.15
24 0.12
25 0.11
26 0.1
27 0.07
28 0.07
29 0.07
30 0.07
31 0.06
32 0.07
33 0.09
34 0.11
35 0.11
36 0.14
37 0.17
38 0.24
39 0.29
40 0.32
41 0.32
42 0.38
43 0.43
44 0.43
45 0.44
46 0.38
47 0.36
48 0.39
49 0.42
50 0.36
51 0.31
52 0.28
53 0.24
54 0.23
55 0.2
56 0.16
57 0.1
58 0.11
59 0.12
60 0.11
61 0.11
62 0.12
63 0.12
64 0.1
65 0.09
66 0.07
67 0.07
68 0.07
69 0.07
70 0.06
71 0.06
72 0.05
73 0.05
74 0.04
75 0.04
76 0.05
77 0.05
78 0.05
79 0.07
80 0.09
81 0.12
82 0.16
83 0.17
84 0.17
85 0.21
86 0.3
87 0.37
88 0.43
89 0.51
90 0.57
91 0.67
92 0.74
93 0.78
94 0.78
95 0.8
96 0.78
97 0.75
98 0.7
99 0.65
100 0.64