Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9VQM6

Protein Details
Accession A0A0C9VQM6    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
50-69TDPKVKKYLKKKAIKFREAKBasic
NLS Segment(s)
PositionSequence
55-64KKYLKKKAIK
Subcellular Location(s) cyto 12, cyto_nucl 10, nucl 6, pero 4, mito 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences ELQWKTGVEKIERKMIEYREVVDRSGSPTEKAGAAENVATAMEEAAESHTDPKVKKYLKKKAIKFREAKTDEERDSVLMDIGKGISLLLMTPFALVGAALLAAGMILDGVAKIAKGIGKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.45
3 0.45
4 0.39
5 0.38
6 0.37
7 0.38
8 0.35
9 0.31
10 0.28
11 0.25
12 0.29
13 0.27
14 0.2
15 0.2
16 0.21
17 0.2
18 0.2
19 0.18
20 0.13
21 0.13
22 0.12
23 0.1
24 0.09
25 0.08
26 0.07
27 0.05
28 0.04
29 0.03
30 0.03
31 0.03
32 0.04
33 0.05
34 0.05
35 0.06
36 0.08
37 0.1
38 0.11
39 0.14
40 0.21
41 0.25
42 0.31
43 0.4
44 0.5
45 0.57
46 0.66
47 0.71
48 0.74
49 0.79
50 0.82
51 0.78
52 0.71
53 0.72
54 0.66
55 0.62
56 0.57
57 0.53
58 0.45
59 0.4
60 0.37
61 0.26
62 0.24
63 0.2
64 0.15
65 0.09
66 0.08
67 0.07
68 0.06
69 0.06
70 0.05
71 0.05
72 0.04
73 0.03
74 0.04
75 0.04
76 0.04
77 0.04
78 0.04
79 0.04
80 0.04
81 0.04
82 0.04
83 0.03
84 0.03
85 0.03
86 0.02
87 0.02
88 0.02
89 0.02
90 0.02
91 0.02
92 0.02
93 0.02
94 0.02
95 0.02
96 0.03
97 0.03
98 0.03
99 0.03
100 0.06