Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9VYL8

Protein Details
Accession A0A0C9VYL8   
Localization Confidence Medium
Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
76-105TEGKKTRQFEKTKLKNKRDKTPLKRRVALAHydrophilic
NLS Segment(s)
PositionSequence
79-101KKTRQFEKTKLKNKRDKTPLKRR
Subcellular Location(s) nucl 21, cyto_nucl 14.333, mito_nucl 11.999, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MVETPESPAASHVTSGSDIEVISIRTCKRVTVDSEDEIEEVPRPSTSEQPLQKRQKTTAVSKGRFTHSHQTQTVRTEGKKTRQFEKTKLKNKRDKTPLKRRVALALPSSEKGSLKSSI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.12
4 0.1
5 0.09
6 0.09
7 0.1
8 0.09
9 0.09
10 0.13
11 0.13
12 0.16
13 0.17
14 0.17
15 0.19
16 0.23
17 0.26
18 0.31
19 0.35
20 0.33
21 0.34
22 0.33
23 0.31
24 0.26
25 0.22
26 0.15
27 0.11
28 0.09
29 0.08
30 0.09
31 0.1
32 0.14
33 0.17
34 0.23
35 0.29
36 0.36
37 0.46
38 0.54
39 0.57
40 0.55
41 0.54
42 0.54
43 0.52
44 0.5
45 0.5
46 0.51
47 0.48
48 0.49
49 0.5
50 0.47
51 0.45
52 0.44
53 0.44
54 0.39
55 0.44
56 0.42
57 0.43
58 0.42
59 0.42
60 0.41
61 0.35
62 0.31
63 0.33
64 0.36
65 0.42
66 0.47
67 0.48
68 0.51
69 0.57
70 0.61
71 0.63
72 0.68
73 0.7
74 0.73
75 0.8
76 0.82
77 0.82
78 0.85
79 0.86
80 0.85
81 0.86
82 0.86
83 0.87
84 0.88
85 0.87
86 0.86
87 0.77
88 0.74
89 0.7
90 0.65
91 0.58
92 0.55
93 0.49
94 0.45
95 0.44
96 0.39
97 0.33
98 0.29