Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9U7I9

Protein Details
Accession A0A0C9U7I9    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
159-183ANISVYPHYRRRKPRSSLSFRILPCHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 8, nucl 6, cyto_mito 6, cyto 4, extr 3, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036188  FAD/NAD-bd_sf  
IPR012132  GMC_OxRdtase  
IPR000172  GMC_OxRdtase_N  
Gene Ontology GO:0050660  F:flavin adenine dinucleotide binding  
GO:0016614  F:oxidoreductase activity, acting on CH-OH group of donors  
GO:0016705  F:oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen  
Pfam View protein in Pfam  
PF00732  GMC_oxred_N  
PROSITE View protein in PROSITE  
PS00623  GMC_OXRED_1  
Amino Acid Sequences MPIVNKDRFLSTQFDYVIVGGGTSGLVLATRLSEDPNVTVGVIEAGIDHADDPAVTIPAMMARNTRNPKYDWEFYTEPQTHVLNRKIQSSRGKGLGGSSMLNNLAFVRPVREELDAFEQLGNPGWNWENIIHYVKKVDFFLLVCLNHMGILIHYFDIRANISVYPHYRRRKPRSSLSFRILPCMAPTVKVH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.25
3 0.23
4 0.21
5 0.15
6 0.12
7 0.06
8 0.06
9 0.05
10 0.04
11 0.04
12 0.03
13 0.03
14 0.03
15 0.03
16 0.04
17 0.05
18 0.06
19 0.08
20 0.09
21 0.1
22 0.11
23 0.12
24 0.12
25 0.1
26 0.1
27 0.09
28 0.08
29 0.06
30 0.05
31 0.04
32 0.04
33 0.04
34 0.04
35 0.04
36 0.04
37 0.04
38 0.04
39 0.04
40 0.05
41 0.05
42 0.05
43 0.05
44 0.05
45 0.08
46 0.09
47 0.09
48 0.11
49 0.12
50 0.21
51 0.27
52 0.3
53 0.29
54 0.3
55 0.37
56 0.41
57 0.45
58 0.38
59 0.39
60 0.39
61 0.37
62 0.44
63 0.38
64 0.32
65 0.29
66 0.28
67 0.23
68 0.27
69 0.3
70 0.27
71 0.27
72 0.33
73 0.32
74 0.37
75 0.42
76 0.41
77 0.41
78 0.37
79 0.36
80 0.29
81 0.28
82 0.24
83 0.17
84 0.13
85 0.1
86 0.08
87 0.08
88 0.08
89 0.07
90 0.06
91 0.06
92 0.06
93 0.06
94 0.07
95 0.08
96 0.09
97 0.11
98 0.12
99 0.12
100 0.13
101 0.18
102 0.17
103 0.16
104 0.15
105 0.14
106 0.13
107 0.14
108 0.12
109 0.07
110 0.08
111 0.08
112 0.08
113 0.09
114 0.1
115 0.1
116 0.13
117 0.17
118 0.16
119 0.16
120 0.19
121 0.18
122 0.2
123 0.18
124 0.16
125 0.14
126 0.13
127 0.17
128 0.18
129 0.17
130 0.16
131 0.16
132 0.15
133 0.14
134 0.13
135 0.1
136 0.06
137 0.07
138 0.07
139 0.07
140 0.07
141 0.07
142 0.08
143 0.09
144 0.1
145 0.1
146 0.1
147 0.11
148 0.12
149 0.17
150 0.21
151 0.27
152 0.35
153 0.43
154 0.51
155 0.61
156 0.7
157 0.75
158 0.79
159 0.83
160 0.86
161 0.86
162 0.86
163 0.82
164 0.8
165 0.7
166 0.68
167 0.58
168 0.48
169 0.4
170 0.37
171 0.3