Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9VPQ1

Protein Details
Accession A0A0C9VPQ1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
52-73LHDCMKTAPRHHRQHRPSINYHHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR017264  Ribosomal_MRP10_mt  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Amino Acid Sequences MSSIPKLKVKPAKLTTPTPCSTELIAMLGCWSATGDALSVEPTKCADVAKALHDCMKTAPRHHRQHRPSINYHLARLNKLIKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.66
3 0.65
4 0.61
5 0.53
6 0.49
7 0.41
8 0.36
9 0.29
10 0.22
11 0.16
12 0.14
13 0.11
14 0.09
15 0.07
16 0.06
17 0.05
18 0.05
19 0.03
20 0.03
21 0.04
22 0.03
23 0.04
24 0.04
25 0.05
26 0.06
27 0.06
28 0.06
29 0.07
30 0.07
31 0.07
32 0.07
33 0.06
34 0.08
35 0.09
36 0.13
37 0.14
38 0.15
39 0.18
40 0.18
41 0.18
42 0.18
43 0.24
44 0.23
45 0.28
46 0.38
47 0.45
48 0.56
49 0.64
50 0.72
51 0.72
52 0.8
53 0.84
54 0.81
55 0.77
56 0.76
57 0.77
58 0.69
59 0.65
60 0.61
61 0.55
62 0.5
63 0.5