Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9V5T3

Protein Details
Accession A0A0C9V5T3    Localization Confidence Low Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MASRQREKLQRVRTRRNCRRLWVRLTSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24, nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR027417  P-loop_NTPase  
CDD cd18809  SF1_C_RecD  
Amino Acid Sequences MASRQREKLQRVRTRRNCRRLWVRLTSAECPRFAAESKTGKFLASSQLPLTLTWAITIHKSQELALERVVIELGLKTFSLGLSFVAMSRVKKLSGLTFKTEFAITWLQKPSSQMQEAMQRDIQHRED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.91
3 0.92
4 0.87
5 0.87
6 0.88
7 0.85
8 0.83
9 0.79
10 0.74
11 0.71
12 0.7
13 0.65
14 0.63
15 0.56
16 0.48
17 0.42
18 0.37
19 0.32
20 0.28
21 0.26
22 0.24
23 0.29
24 0.3
25 0.32
26 0.31
27 0.29
28 0.28
29 0.25
30 0.25
31 0.19
32 0.19
33 0.16
34 0.18
35 0.18
36 0.18
37 0.19
38 0.13
39 0.11
40 0.1
41 0.1
42 0.08
43 0.09
44 0.1
45 0.09
46 0.09
47 0.09
48 0.09
49 0.13
50 0.15
51 0.15
52 0.14
53 0.14
54 0.13
55 0.12
56 0.12
57 0.07
58 0.05
59 0.04
60 0.04
61 0.04
62 0.04
63 0.04
64 0.04
65 0.04
66 0.05
67 0.05
68 0.05
69 0.05
70 0.05
71 0.05
72 0.08
73 0.1
74 0.1
75 0.13
76 0.14
77 0.14
78 0.15
79 0.17
80 0.22
81 0.29
82 0.32
83 0.34
84 0.35
85 0.35
86 0.36
87 0.34
88 0.26
89 0.21
90 0.26
91 0.21
92 0.24
93 0.28
94 0.28
95 0.29
96 0.32
97 0.34
98 0.34
99 0.35
100 0.31
101 0.32
102 0.4
103 0.41
104 0.43
105 0.4
106 0.36
107 0.37