Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9UXV7

Protein Details
Accession A0A0C9UXV7   
Localization Confidence Medium
Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
24-53HLEQKRQYYSRNKKAEQRKSRKRYEHMIAEHydrophilic
NLS Segment(s)
PositionSequence
34-65RNKKAEQRKSRKRYEHMIAEGRPKLRRPPPPK
Subcellular Location(s) nucl 17.5, cyto_nucl 10.5, mito 6
Family & Domain DBs
Amino Acid Sequences MAYKPASMGRRRKYNTPEEAHAAHLEQKRQYYSRNKKAEQRKSRKRYEHMIAEGRPKLRRPPPPKAVSLKPVQEVPTELSIIVTAPASFKPRLRVAPNTKMDILIAALWKRLMGTTPPRFLLHAQKSRYEAIMNMFETLSHETAMSRLLQMTAEGKVLVDTAWKAMKEAIRRDPSQRSPEVPMVVCAHREIEQIQGLTEECKSYLKMGISSLEEAHRKKWLCWQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.77
3 0.74
4 0.7
5 0.65
6 0.62
7 0.56
8 0.48
9 0.4
10 0.38
11 0.35
12 0.34
13 0.32
14 0.34
15 0.37
16 0.38
17 0.44
18 0.48
19 0.55
20 0.61
21 0.67
22 0.68
23 0.73
24 0.82
25 0.85
26 0.85
27 0.85
28 0.86
29 0.86
30 0.91
31 0.91
32 0.87
33 0.85
34 0.82
35 0.79
36 0.76
37 0.74
38 0.66
39 0.64
40 0.62
41 0.57
42 0.51
43 0.44
44 0.46
45 0.47
46 0.54
47 0.55
48 0.61
49 0.67
50 0.7
51 0.74
52 0.72
53 0.69
54 0.64
55 0.62
56 0.55
57 0.46
58 0.43
59 0.37
60 0.31
61 0.28
62 0.24
63 0.2
64 0.17
65 0.15
66 0.12
67 0.11
68 0.1
69 0.09
70 0.06
71 0.04
72 0.05
73 0.06
74 0.1
75 0.11
76 0.13
77 0.17
78 0.2
79 0.25
80 0.28
81 0.37
82 0.41
83 0.5
84 0.52
85 0.5
86 0.47
87 0.42
88 0.37
89 0.28
90 0.2
91 0.12
92 0.1
93 0.07
94 0.07
95 0.07
96 0.07
97 0.07
98 0.06
99 0.06
100 0.08
101 0.16
102 0.21
103 0.23
104 0.24
105 0.25
106 0.26
107 0.27
108 0.34
109 0.34
110 0.36
111 0.36
112 0.37
113 0.4
114 0.4
115 0.38
116 0.29
117 0.21
118 0.17
119 0.19
120 0.17
121 0.15
122 0.14
123 0.13
124 0.14
125 0.16
126 0.13
127 0.09
128 0.09
129 0.08
130 0.09
131 0.1
132 0.08
133 0.06
134 0.06
135 0.06
136 0.06
137 0.07
138 0.08
139 0.08
140 0.08
141 0.08
142 0.07
143 0.07
144 0.07
145 0.06
146 0.06
147 0.06
148 0.08
149 0.1
150 0.1
151 0.11
152 0.14
153 0.18
154 0.23
155 0.29
156 0.36
157 0.4
158 0.42
159 0.47
160 0.53
161 0.57
162 0.58
163 0.55
164 0.49
165 0.48
166 0.5
167 0.49
168 0.41
169 0.37
170 0.33
171 0.31
172 0.28
173 0.23
174 0.21
175 0.18
176 0.19
177 0.17
178 0.17
179 0.19
180 0.19
181 0.18
182 0.17
183 0.16
184 0.16
185 0.16
186 0.13
187 0.1
188 0.12
189 0.12
190 0.13
191 0.17
192 0.18
193 0.19
194 0.2
195 0.23
196 0.24
197 0.25
198 0.25
199 0.26
200 0.3
201 0.3
202 0.32
203 0.36
204 0.35