Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9US23

Protein Details
Accession A0A0C9US23    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MSFSLKKPKSKTKLTMRGVSVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15.5, cyto_mito 11.5, cyto 6.5, extr 3
Family & Domain DBs
Amino Acid Sequences MSFSLKKPKSKTKLTMRGVSVSLALGDKDAPKAELVNIEVDEEIDRANATVYIGKDSSVGIANGIPRNVFIPSRNMQST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.81
3 0.73
4 0.67
5 0.58
6 0.49
7 0.38
8 0.27
9 0.21
10 0.13
11 0.1
12 0.07
13 0.07
14 0.07
15 0.08
16 0.08
17 0.08
18 0.08
19 0.08
20 0.08
21 0.09
22 0.09
23 0.1
24 0.09
25 0.09
26 0.09
27 0.08
28 0.08
29 0.06
30 0.06
31 0.04
32 0.04
33 0.04
34 0.04
35 0.04
36 0.04
37 0.07
38 0.08
39 0.1
40 0.1
41 0.1
42 0.11
43 0.1
44 0.11
45 0.1
46 0.1
47 0.08
48 0.09
49 0.13
50 0.15
51 0.16
52 0.14
53 0.13
54 0.15
55 0.17
56 0.17
57 0.15
58 0.2
59 0.24