Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9TVD8

Protein Details
Accession A0A0C9TVD8    Localization Confidence High Confidence Score 16.2
NoLS Segment(s)
PositionSequenceProtein Nature
157-184SSQAGSPYRYRKPKPKGSVEKPFYKRLIHydrophilic
NLS Segment(s)
PositionSequence
86-92SRPKPKR
168-172KPKPK
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MPVASPLSSPRHSPRSTPRDSPGASPKPIARRVQSHDAYKPSSPRREHHTPPSPSRPTATRRHTSQPVPSRSANRPLPALPEDSRSRPKPKRVHSAPIPTKDGNILIPVPVRARDAESPVYVRASPGQKVDFVFSPPKKKSFISRLLEKVDWDDGTSSQAGSPYRYRKPKPKGSVEKPFYKRLIP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.58
3 0.64
4 0.64
5 0.62
6 0.62
7 0.62
8 0.61
9 0.6
10 0.57
11 0.52
12 0.5
13 0.5
14 0.5
15 0.55
16 0.54
17 0.49
18 0.5
19 0.56
20 0.62
21 0.62
22 0.59
23 0.58
24 0.58
25 0.56
26 0.52
27 0.53
28 0.51
29 0.54
30 0.52
31 0.5
32 0.54
33 0.59
34 0.62
35 0.64
36 0.66
37 0.65
38 0.68
39 0.74
40 0.7
41 0.63
42 0.59
43 0.54
44 0.5
45 0.53
46 0.52
47 0.49
48 0.49
49 0.56
50 0.59
51 0.57
52 0.6
53 0.6
54 0.58
55 0.56
56 0.54
57 0.52
58 0.5
59 0.55
60 0.48
61 0.4
62 0.37
63 0.32
64 0.33
65 0.29
66 0.29
67 0.22
68 0.23
69 0.25
70 0.27
71 0.33
72 0.33
73 0.41
74 0.42
75 0.51
76 0.55
77 0.6
78 0.66
79 0.65
80 0.69
81 0.67
82 0.72
83 0.69
84 0.65
85 0.62
86 0.51
87 0.47
88 0.39
89 0.32
90 0.22
91 0.17
92 0.12
93 0.08
94 0.09
95 0.09
96 0.09
97 0.09
98 0.1
99 0.09
100 0.12
101 0.13
102 0.16
103 0.17
104 0.18
105 0.18
106 0.18
107 0.19
108 0.16
109 0.15
110 0.16
111 0.17
112 0.18
113 0.19
114 0.2
115 0.2
116 0.21
117 0.23
118 0.19
119 0.2
120 0.27
121 0.28
122 0.36
123 0.38
124 0.4
125 0.4
126 0.42
127 0.47
128 0.47
129 0.53
130 0.52
131 0.57
132 0.59
133 0.62
134 0.61
135 0.52
136 0.46
137 0.39
138 0.32
139 0.25
140 0.21
141 0.15
142 0.17
143 0.17
144 0.14
145 0.11
146 0.14
147 0.14
148 0.17
149 0.24
150 0.29
151 0.38
152 0.48
153 0.55
154 0.63
155 0.72
156 0.79
157 0.82
158 0.85
159 0.87
160 0.87
161 0.91
162 0.88
163 0.88
164 0.83
165 0.81