Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9V0K3

Protein Details
Accession A0A0C9V0K3   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
102-124QRPLRRPHGRYHPLQRLHHRSTRBasic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 13.5, cyto 12, nucl 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR000277  Cys/Met-Metab_PyrdxlP-dep_enz  
IPR015424  PyrdxlP-dep_Trfase  
IPR015421  PyrdxlP-dep_Trfase_major  
Gene Ontology GO:0003824  F:catalytic activity  
GO:0030170  F:pyridoxal phosphate binding  
GO:0019346  P:transsulfuration  
Pfam View protein in Pfam  
PF01053  Cys_Met_Meta_PP  
Amino Acid Sequences MSKVASQLQGLETTFVDFNSATDEEVLASIRPNTKLIRIEPPTNPTLRLLPIAHITFLIHSLPVASRPLIAIDSTILSPFYDSPLAAPISGDLVVYSITIHQRPLRRPHGRYHPLQRLHHRSTR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.13
3 0.13
4 0.1
5 0.1
6 0.13
7 0.13
8 0.11
9 0.11
10 0.11
11 0.1
12 0.1
13 0.11
14 0.06
15 0.07
16 0.09
17 0.12
18 0.13
19 0.15
20 0.16
21 0.2
22 0.24
23 0.26
24 0.33
25 0.35
26 0.39
27 0.39
28 0.43
29 0.41
30 0.38
31 0.35
32 0.27
33 0.25
34 0.21
35 0.21
36 0.17
37 0.15
38 0.18
39 0.17
40 0.16
41 0.14
42 0.13
43 0.1
44 0.11
45 0.09
46 0.05
47 0.04
48 0.05
49 0.05
50 0.06
51 0.06
52 0.06
53 0.06
54 0.06
55 0.07
56 0.07
57 0.07
58 0.06
59 0.05
60 0.06
61 0.06
62 0.06
63 0.06
64 0.05
65 0.06
66 0.06
67 0.07
68 0.07
69 0.07
70 0.07
71 0.1
72 0.1
73 0.1
74 0.09
75 0.08
76 0.09
77 0.09
78 0.08
79 0.05
80 0.05
81 0.05
82 0.05
83 0.05
84 0.06
85 0.09
86 0.1
87 0.13
88 0.18
89 0.25
90 0.32
91 0.41
92 0.5
93 0.56
94 0.59
95 0.66
96 0.73
97 0.74
98 0.76
99 0.77
100 0.77
101 0.76
102 0.82
103 0.83
104 0.81