Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9UKC1

Protein Details
Accession A0A0C9UKC1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
56-75LRRAHHPHRHKLMPRMPRRCBasic
NLS Segment(s)
Subcellular Location(s) mito 11, plas 9, E.R. 2, golg 2, cyto 1, extr 1, vacu 1
Family & Domain DBs
Amino Acid Sequences AKHIRLRPPIPTLPILPQNKHNLLILLLLPIPLPLLHLSSLLHLPLPLITPPMHMLRRAHHPHRHKLMPRMPRRCWWRSPM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.48
3 0.43
4 0.44
5 0.47
6 0.46
7 0.45
8 0.4
9 0.31
10 0.27
11 0.25
12 0.19
13 0.12
14 0.1
15 0.09
16 0.08
17 0.07
18 0.07
19 0.05
20 0.06
21 0.05
22 0.06
23 0.06
24 0.07
25 0.07
26 0.08
27 0.08
28 0.07
29 0.07
30 0.05
31 0.05
32 0.05
33 0.06
34 0.05
35 0.07
36 0.07
37 0.08
38 0.1
39 0.15
40 0.16
41 0.18
42 0.2
43 0.21
44 0.32
45 0.39
46 0.45
47 0.5
48 0.57
49 0.64
50 0.71
51 0.77
52 0.74
53 0.76
54 0.76
55 0.78
56 0.8
57 0.8
58 0.76
59 0.76
60 0.78
61 0.75