Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9VSN3

Protein Details
Accession A0A0C9VSN3    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
9-39EHIKRHGRRLDYFERKRKRLARESHKNSAVABasic
45-66LKAKLLHKKRHAEKVQLKKTLKBasic
NLS Segment(s)
PositionSequence
14-64HGRRLDYFERKRKRLARESHKNSAVAQKVFGLKAKLLHKKRHAEKVQLKKT
109-114KRKDKA
Subcellular Location(s) nucl 19.5, cyto_nucl 14, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039411  NSA2_fam  
IPR022309  Ribosomal_S8e/biogenesis_NSA2  
Gene Ontology GO:0005730  C:nucleolus  
GO:1990904  C:ribonucleoprotein complex  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF01201  Ribosomal_S8e  
CDD cd11381  NSA2  
Amino Acid Sequences MAQNEYIEEHIKRHGRRLDYFERKRKRLARESHKNSAVAQKVFGLKAKLLHKKRHAEKVQLKKTLKAHDERNVKQTAPASKPDGALPTYLLDREEQRDAKALSTALKQKRKDKAAKYAVPLPKVRGIAEEEMFKVLRTGKSKSKSWKRMVTKATFVGEGFTRKPVKMERFVRPMALRYKKANVTHPDLKATFQLSILGVKKNPQSPMYTQLGVMTKGTIIEVNVSELGMVTTGGKVVFGKYAQVTNNPENDGCINAVLLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.49
3 0.54
4 0.61
5 0.64
6 0.68
7 0.77
8 0.78
9 0.81
10 0.79
11 0.82
12 0.81
13 0.8
14 0.79
15 0.8
16 0.8
17 0.81
18 0.86
19 0.86
20 0.82
21 0.73
22 0.66
23 0.64
24 0.59
25 0.49
26 0.41
27 0.35
28 0.34
29 0.34
30 0.34
31 0.27
32 0.21
33 0.27
34 0.35
35 0.41
36 0.45
37 0.53
38 0.59
39 0.67
40 0.74
41 0.78
42 0.76
43 0.77
44 0.79
45 0.81
46 0.81
47 0.81
48 0.74
49 0.7
50 0.7
51 0.68
52 0.64
53 0.59
54 0.57
55 0.56
56 0.64
57 0.6
58 0.6
59 0.54
60 0.48
61 0.45
62 0.43
63 0.42
64 0.36
65 0.36
66 0.35
67 0.34
68 0.35
69 0.33
70 0.3
71 0.23
72 0.2
73 0.17
74 0.14
75 0.12
76 0.12
77 0.11
78 0.1
79 0.11
80 0.14
81 0.18
82 0.17
83 0.17
84 0.21
85 0.21
86 0.21
87 0.2
88 0.17
89 0.15
90 0.18
91 0.26
92 0.29
93 0.36
94 0.4
95 0.47
96 0.54
97 0.61
98 0.65
99 0.63
100 0.66
101 0.68
102 0.68
103 0.63
104 0.64
105 0.59
106 0.54
107 0.49
108 0.41
109 0.35
110 0.32
111 0.28
112 0.21
113 0.21
114 0.19
115 0.19
116 0.18
117 0.14
118 0.14
119 0.14
120 0.12
121 0.1
122 0.1
123 0.13
124 0.15
125 0.19
126 0.25
127 0.3
128 0.35
129 0.44
130 0.53
131 0.59
132 0.63
133 0.69
134 0.68
135 0.72
136 0.74
137 0.68
138 0.61
139 0.55
140 0.49
141 0.4
142 0.33
143 0.26
144 0.2
145 0.18
146 0.15
147 0.17
148 0.18
149 0.17
150 0.2
151 0.25
152 0.3
153 0.37
154 0.43
155 0.45
156 0.5
157 0.5
158 0.52
159 0.47
160 0.46
161 0.46
162 0.47
163 0.43
164 0.4
165 0.46
166 0.48
167 0.5
168 0.53
169 0.49
170 0.51
171 0.54
172 0.52
173 0.51
174 0.45
175 0.43
176 0.37
177 0.33
178 0.25
179 0.18
180 0.18
181 0.13
182 0.17
183 0.18
184 0.19
185 0.18
186 0.21
187 0.26
188 0.29
189 0.32
190 0.29
191 0.32
192 0.32
193 0.38
194 0.39
195 0.35
196 0.31
197 0.32
198 0.32
199 0.28
200 0.25
201 0.18
202 0.13
203 0.13
204 0.13
205 0.09
206 0.07
207 0.09
208 0.09
209 0.11
210 0.11
211 0.1
212 0.1
213 0.09
214 0.09
215 0.06
216 0.06
217 0.05
218 0.05
219 0.06
220 0.06
221 0.06
222 0.07
223 0.08
224 0.1
225 0.1
226 0.14
227 0.15
228 0.2
229 0.21
230 0.27
231 0.33
232 0.36
233 0.4
234 0.39
235 0.37
236 0.35
237 0.34
238 0.3
239 0.24
240 0.18