Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9UU74

Protein Details
Accession A0A0C9UU74    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MPPQRRDRSPTRQQYKKKTILAYHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21.5, cyto_mito 13, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MPPQRRDRSPTRQQYKKKTILAYIALKLTQEEESEGACLPVLLYAVRIPRLLPGVPTGVLATVVAREERTSKSRPEIGGRKIDWEYLAEMTESQCEWAFRLPNTGAYKLKALLGNQRDRLVNTDVEWN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.9
3 0.88
4 0.84
5 0.77
6 0.72
7 0.68
8 0.65
9 0.58
10 0.5
11 0.43
12 0.36
13 0.32
14 0.27
15 0.23
16 0.17
17 0.12
18 0.11
19 0.1
20 0.1
21 0.11
22 0.1
23 0.09
24 0.07
25 0.06
26 0.05
27 0.05
28 0.05
29 0.04
30 0.04
31 0.06
32 0.08
33 0.09
34 0.09
35 0.09
36 0.1
37 0.13
38 0.12
39 0.11
40 0.11
41 0.11
42 0.11
43 0.11
44 0.1
45 0.08
46 0.07
47 0.07
48 0.05
49 0.04
50 0.04
51 0.04
52 0.04
53 0.05
54 0.07
55 0.1
56 0.14
57 0.16
58 0.18
59 0.22
60 0.26
61 0.27
62 0.33
63 0.38
64 0.39
65 0.44
66 0.42
67 0.42
68 0.38
69 0.37
70 0.3
71 0.23
72 0.2
73 0.14
74 0.14
75 0.1
76 0.09
77 0.09
78 0.1
79 0.09
80 0.08
81 0.08
82 0.08
83 0.09
84 0.13
85 0.15
86 0.15
87 0.2
88 0.2
89 0.26
90 0.3
91 0.34
92 0.32
93 0.31
94 0.33
95 0.28
96 0.31
97 0.27
98 0.25
99 0.3
100 0.36
101 0.42
102 0.44
103 0.46
104 0.45
105 0.43
106 0.46
107 0.4
108 0.33